SecReT6
Protein ID: 320158750
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03903
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1069201..1069644 [-]
Producthypothetical protein
NoteTssE
UniProt IDE8VUR0
KEGG IDvvm:VVMO6_03903
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.40E-21, Aligned region: 20..127
Protein Sequence: 147 a.a.     [Download]
>gi|320158750|ref|YP_004191128.1| hypothetical protein VVMO6_03903 [Vibrio vulnificus MO6-24/O]
MDKLTDSDPLSSIDRDFPLTRHALMDSLRRDLESLLNSRINWMTLSDELREIQTSILRYGLPDFSSMPFS
SADGQQVLCQRVKETIQQYEPRLNYVSVAIAEDKNPLDRILKLRIKATCMIDNNEQELVMDSEVEPVSLG
IKLSRAK
 
Nucleotide Sequence: 444 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1069644-1069201 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGGATAAATTGACGGACAGTGATCCTCTGAGCAGCATTGATAGAGACTTTCCATTAACGCGACATGCGT
TGATGGATTCACTCAGACGAGATCTTGAATCATTACTCAACAGCCGTATCAACTGGATGACGTTGTCAGA
TGAGCTACGTGAAATACAGACGTCTATCTTGCGATATGGTTTGCCAGATTTCTCATCAATGCCATTTAGC
AGCGCGGATGGGCAACAGGTTCTGTGCCAACGAGTGAAAGAAACCATTCAACAGTATGAACCTAGGCTCA
ACTATGTGTCGGTCGCCATTGCAGAAGACAAAAATCCGCTAGATCGAATTTTAAAACTCAGAATCAAGGC
GACCTGCATGATTGATAATAACGAGCAGGAGTTGGTTATGGATTCGGAAGTTGAGCCCGTCAGTCTAGGG
ATAAAACTGAGTAGAGCGAAATGA
 Primer design