SecReT6
Protein ID: 320158751
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03904
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1069671..1070474 [-]
Productprotein of avirulence locus ImpE
NoteTagJ
UniProt IDE8VUR1
KEGG IDvvm:VVMO6_03904
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.00E-38, Aligned region: 138..259
Protein Sequence: 267 a.a.     [Download]
>gi|320158751|ref|YP_004191129.1| protein of avirulence locus ImpE [Vibrio vulnificus MO6-24/O]
MSDWQDHLSRSELELAKQALIKEIKLAPKNATIRSKFIELLCIMGEFERADEQLMQSIKLFPEYLPGASQ
IRHLVKAAQARKDFFAGAASAQFIEGTEKLGETIVQFILAQKENNHEELISVCERAEQSRQALQFEINGV
RYDDVRDLDDRLGGFIELFSSAGNYFLVPMDHLHYLELKPATNMLETLWRPCEFDIQGLGEGEAHFPMTY
VDSESGNQKLGRETDWKNVLGTDHCIGQGQKMWLVGDNALALSQLERVALAVETTIE
 
Nucleotide Sequence: 804 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1070474-1069671 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGTCAGATTGGCAAGACCACCTCAGTCGAAGCGAGCTCGAACTCGCCAAACAAGCGCTGATTAAAGAAA
TCAAATTGGCGCCCAAAAACGCCACTATTCGCAGCAAGTTTATTGAACTGCTATGCATCATGGGCGAGTT
TGAGCGCGCGGATGAACAGTTAATGCAGTCCATTAAGTTGTTCCCTGAGTATTTGCCCGGAGCAAGCCAA
ATTCGTCATCTGGTTAAAGCTGCTCAAGCAAGAAAGGACTTTTTTGCAGGCGCCGCATCAGCGCAATTCA
TAGAGGGTACCGAAAAACTGGGTGAAACGATTGTTCAGTTCATTTTGGCGCAAAAAGAGAACAACCATGA
GGAACTGATCTCGGTGTGTGAGCGTGCAGAGCAATCCCGTCAAGCACTCCAATTTGAAATTAATGGTGTG
CGCTATGATGATGTGAGAGATCTCGATGATCGATTGGGGGGCTTCATTGAGCTCTTTTCTTCCGCAGGTA
ACTATTTCTTAGTTCCGATGGACCATCTCCATTACTTGGAACTCAAACCCGCCACCAACATGTTGGAAAC
ACTATGGCGACCATGCGAGTTCGATATTCAAGGACTTGGCGAAGGTGAAGCTCATTTCCCAATGACGTAC
GTAGATTCCGAAAGTGGCAACCAAAAACTGGGCAGAGAAACGGACTGGAAAAATGTTCTAGGTACGGATC
ACTGCATCGGTCAAGGGCAAAAGATGTGGCTGGTTGGTGACAATGCGCTGGCTTTGAGCCAATTAGAACG
AGTCGCCTTGGCTGTGGAAACCACGATTGAATGA
 Primer design