SecReT6
Protein ID: 320158752
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03905
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1070485..1071978 [-]
Producthypothetical protein
NoteTssC
UniProt IDE8VUR2
KEGG IDvvm:VVMO6_03905
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-164, Aligned region: 60..491
Protein Sequence: 497 a.a.     [Download]
>gi|320158752|ref|YP_004191130.1| hypothetical protein VVMO6_03905 [Vibrio vulnificus MO6-24/O]
MNFIEIEQLSHDLPTPESALENGIWMAHFLDAKTMTQMVSYWVEISGAKTKQEFVHSIISAIESIDREVS
AQLDEILHHRQMQKLEATWRGLNYLVQQKDHNAGELVKVKVLSCTWEELKKDSERAIEFDQSALFKLVYQ
NEYSMPGGEPFGLLIGDYYLCGGQNAMVVEREINILRKIAQSAAAAFSPFIMSVEPSVFGSDYFENIASM
TNVYAQFEQNEYVSWKRLRAEEDVRFIGLTLPNLLYRQPYQSDGSRSDSFVYNERVRDSHQDLLWGNAAY
SFAAVIVRAFQEHGWFTHIRGHKTGDYSQGIIQPPSLCQVDLPGKGGRYRAPLNLKITEKREQELADCGF
IPLSPVAETPFVSFTSNISLHKPQQFASKGASVNARLSSMLQYTLCVSRIAHYLKVMGRDRIGSYQDAQS
IERDFQAWLHKYTTASDEASDELRAKYPLNEAKIKVTEKLGSPGKYYSVIHLRPHFQLDQMVSSIKLITE
LSPEHIV
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1071978-1070485 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGAATTTCATCGAAATTGAGCAACTTTCCCACGATTTACCGACACCAGAGTCTGCTTTGGAGAATGGTA
TTTGGATGGCGCATTTTCTTGATGCCAAGACGATGACGCAGATGGTGAGCTATTGGGTTGAGATTTCTGG
AGCGAAAACGAAACAAGAGTTTGTTCACAGCATCATCAGTGCCATTGAATCGATTGATAGGGAAGTGAGC
GCTCAACTGGATGAGATTCTTCATCACCGACAAATGCAAAAGCTTGAAGCGACGTGGCGAGGCTTAAATT
ACCTTGTGCAGCAGAAAGATCACAATGCCGGAGAGCTTGTAAAGGTCAAAGTCCTATCTTGTACATGGGA
AGAGCTGAAGAAAGACAGTGAGCGAGCGATAGAGTTCGATCAATCCGCGCTGTTTAAGTTGGTCTATCAA
AACGAATACTCGATGCCAGGGGGAGAGCCGTTTGGTTTATTGATTGGCGACTATTATCTCTGTGGCGGTC
AAAACGCCATGGTGGTTGAAAGAGAAATCAACATATTAAGGAAAATTGCGCAGTCGGCAGCAGCGGCGTT
TAGCCCTTTCATTATGTCGGTCGAACCGAGTGTTTTTGGTTCAGATTACTTTGAAAACATCGCGTCGATG
ACGAACGTCTATGCCCAATTTGAGCAAAATGAATACGTGAGTTGGAAACGACTACGAGCCGAAGAAGATG
TTCGGTTTATTGGTTTAACGCTACCCAACCTTTTGTATCGTCAGCCATATCAAAGTGACGGCTCGAGATC
GGATTCGTTTGTTTATAACGAACGAGTTCGAGATTCGCACCAAGATTTGTTGTGGGGAAATGCCGCCTAT
TCCTTTGCCGCGGTCATTGTTAGAGCATTTCAAGAGCATGGTTGGTTTACACACATACGTGGACATAAAA
CAGGGGACTACTCTCAAGGCATTATCCAGCCTCCTTCTTTATGTCAGGTTGATTTACCAGGAAAGGGAGG
GCGATATCGCGCACCTCTCAACTTAAAAATAACGGAAAAAAGAGAGCAAGAGTTGGCAGATTGTGGATTT
ATCCCTCTGTCCCCCGTCGCTGAAACGCCGTTTGTTAGCTTTACGTCGAACATCTCTTTGCACAAACCTC
AGCAGTTTGCTTCCAAGGGAGCGAGTGTAAATGCACGTTTGTCTTCGATGTTGCAATACACCTTATGTGT
TTCAAGAATTGCTCACTATTTAAAAGTGATGGGAAGAGATCGGATTGGCAGCTATCAAGATGCCCAATCG
ATAGAACGAGATTTTCAGGCGTGGCTTCATAAATATACCACTGCGTCTGATGAGGCTTCGGATGAACTGA
GAGCAAAATATCCGCTTAACGAAGCCAAAATAAAAGTCACTGAAAAGCTAGGTAGCCCAGGAAAATATTA
TTCGGTGATCCACCTACGGCCCCATTTTCAACTGGATCAAATGGTTTCATCGATCAAGTTGATTACGGAG
TTGTCTCCTGAGCATATTGTATAA
 Primer design