SecReT6
Protein ID: 320158753
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03906
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1072023..1073516 [-]
Producthypothetical protein
NoteTssC
UniProt IDE8VUR3
KEGG IDvvm:VVMO6_03906
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-188, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|320158753|ref|YP_004191131.1| hypothetical protein VVMO6_03906 [Vibrio vulnificus MO6-24/O]
MTTQLETQLDPTVEGQSFSFLEQAIGATKQTEASRAEELIKTLTEEALKGTVTWNKNLTVTFREAITALD
KKISEQLSAVMHHPELQKLEGTWRGLNYLVMNSETSSTLKIRMVSMTKKELHKDLSKAVEFDQSQVFKKV
YESEFGSAGGEPYGAIIGDYEFTNHPEDIETLRLMSNVAAAGFSPFLSAASPALFGFDEWTELSKPRDLE
KVFESLEYTQWRAFRESQDSRFVSLTMPKVLARLPYGQATSPVEEFGFEEFSVDETTGIAVNAQHNDYCW
MNSSYVLGAKLTDAFAKYGFCTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRRESELGKLG
FLPLCHYKNTNYAVFFGAQTCQKPAKYDSPDATANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVREVPGAPGAYNAVAWLKPWLQMEELTTSLRLVA
KIPQSGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1073516-1072023 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGACAACACAGCTTGAAACACAATTAGACCCCACCGTTGAAGGCCAGAGTTTTTCCTTCTTAGAACAAG
CGATTGGCGCGACCAAACAAACGGAAGCGTCGAGAGCAGAAGAGTTAATCAAAACATTAACAGAAGAAGC
TTTAAAAGGTACGGTAACGTGGAATAAAAACCTAACCGTGACGTTTCGTGAAGCCATTACCGCTTTGGAC
AAAAAGATTTCCGAACAGCTGTCTGCGGTGATGCATCACCCTGAGTTGCAAAAGTTGGAAGGAACGTGGC
GTGGGTTGAATTATCTGGTGATGAATTCGGAAACGAGCTCCACGTTAAAGATTCGTATGGTGAGTATGAC
CAAGAAAGAGCTGCACAAAGATTTGAGTAAAGCAGTGGAGTTCGATCAAAGCCAGGTCTTTAAGAAAGTC
TACGAATCAGAATTCGGTAGTGCTGGTGGTGAGCCATATGGTGCGATCATTGGTGACTATGAATTTACGA
ATCATCCAGAAGATATTGAAACGCTGCGTCTTATGTCGAATGTTGCGGCAGCTGGTTTTTCTCCATTCCT
TTCTGCCGCCTCACCTGCGTTGTTTGGTTTTGACGAATGGACGGAATTGTCGAAGCCTAGAGATTTAGAG
AAAGTATTTGAGTCGCTCGAGTACACTCAGTGGCGCGCATTCCGTGAAAGCCAAGACTCACGCTTTGTCA
GCTTGACGATGCCGAAAGTCCTTGCTCGACTTCCTTATGGACAAGCGACATCGCCAGTCGAAGAGTTTGG
TTTTGAAGAGTTTTCCGTAGACGAAACCACCGGAATTGCCGTGAATGCGCAGCACAACGACTACTGCTGG
ATGAACTCGTCGTATGTACTGGGAGCGAAGCTCACTGACGCATTTGCCAAGTATGGATTCTGCACGGCAA
TTCGTGGTGCTGAGGGTGGTGGTCGTGTCGACAATCTGCCAACGCACTTCTTTATGAGTGACGATGGCGA
TCCAGATATGAAATGCCCGACCGAAATTGGCATTACTGACCGTCGTGAATCCGAGTTAGGTAAACTGGGC
TTCCTGCCTTTATGTCACTATAAGAATACCAACTACGCTGTATTCTTTGGTGCGCAAACCTGCCAAAAAC
CAGCCAAATACGATTCGCCAGATGCCACTGCGAATGCTGCGATTTCTGCGCGCTTGCCTTACATGATGGC
GACTTCTCGTTTTGCGCATTATCTCAAGGTCATGGCGCGAGATAAGATTGGTAGCTTCATGGAAGCAGAA
GACGTTGAGTCATGGCTAAATCGATGGATCCTTGGCTACGTCAACGCGTCGGAAGGCGGTGGTCAAGAGA
TCCGTGCGAAATACCCGTTGGCGGATGCGCGAGTGCAGGTCAGAGAAGTTCCTGGCGCACCGGGTGCTTA
CAACGCGGTCGCGTGGCTTAAGCCTTGGCTGCAAATGGAAGAGCTCACAACGTCTCTCCGTTTGGTAGCG
AAAATCCCTCAGTCTGGCGGATAA
 Primer design