SecReT6
Protein ID: 320158754
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03907
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1073528..1074040 [-]
Producthypothetical protein
NoteTssB
UniProt IDE8VUR4
KEGG IDvvm:VVMO6_03907
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-61, Aligned region: 8..162
Protein Sequence: 170 a.a.     [Download]
>gi|320158754|ref|YP_004191132.1| hypothetical protein VVMO6_03907 [Vibrio vulnificus MO6-24/O]
MTSIHSKLSRVRKPRVHITYDVETEGTSLKKELPFVVGVMGDFAGQNTEALKPLKDRRFIQIDRDNFDDV
LKKMSPSVEFKVKNTMVDDGTEFAVNLQFQSMKDFEPASIVRQVDPLRQLMDTRNKLRDLMTKVDRSEEL
ENVLEAVLNNTDNLSKLADELKLGQEEKAE
 
Nucleotide Sequence: 513 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1074040-1073528 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGACTAGTATCCACTCGAAATTATCGCGAGTACGGAAGCCACGTGTTCATATTACCTATGATGTTGAAA
CAGAAGGCACATCACTGAAGAAAGAACTTCCGTTTGTAGTGGGTGTGATGGGGGATTTTGCTGGCCAAAA
TACTGAAGCCCTCAAACCACTAAAAGACCGTCGCTTTATTCAAATTGATCGAGACAACTTTGATGATGTA
CTCAAGAAAATGAGTCCATCAGTGGAGTTTAAAGTGAAAAACACGATGGTGGATGACGGAACGGAATTTG
CGGTCAATCTGCAGTTCCAATCGATGAAGGATTTCGAACCCGCCTCGATTGTTAGACAAGTTGATCCGCT
TCGTCAATTAATGGACACACGCAACAAATTGCGTGACCTAATGACCAAAGTTGACCGTTCAGAAGAACTA
GAAAACGTGCTTGAAGCGGTTTTGAACAACACCGACAACCTATCTAAATTGGCTGATGAACTCAAGTTAG
GCCAAGAAGAGAAAGCGGAGTAA
 Primer design