SecReT6
Protein ID: 320158755
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03908
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1074057..1075190 [-]
Productserine/threonine protein phosphatase
NoteTssA
UniProt IDE8VUR5
KEGG IDvvm:VVMO6_03908
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-20, Aligned region: 69..129
Protein Sequence: 377 a.a.     [Download]
>gi|320158755|ref|YP_004191133.1| serine/threonine protein phosphatase [Vibrio vulnificus MO6-24/O]
MSHHYEEFTWFEPALLPISAEQPAGVDPRSDITPQSLYYRLKDQRMQARNIERNAIIEEEPILNYANLWQ
VFLDEVPQALTSQTKDLEYVAWLIEALTRLDGFKGMAVGYELATYYLENYWADLYPMPDEDGLETRISPI
IGLNGIDNEGTLIFPLSCIPMTEGLLEQPYAYWEYQQALDLERCDEDKKRAKRDQGVPELSDITQAVKSS
SSQFYQRLIEDLNRAISSFERFSQALDSACEEVTPSSYISRKLDAIHSAIMHLASDKMIKVSKETNSDEP
SHSASSHEGEIDGRGQGEANFQLLAANMHSREQAIVHLQRVADFFRETEPHSPVSYTIEQVIRWCGMSLP
ELLAELISDGDAKKGYFRLVGIADKNE
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1075190-1074057 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGAGTCATCACTATGAGGAGTTCACTTGGTTTGAGCCGGCCTTACTGCCAATTTCTGCCGAGCAGCCAG
CAGGTGTGGATCCAAGAAGTGATATTACGCCTCAGTCACTCTATTACCGACTGAAAGACCAGAGAATGCA
GGCGAGAAATATTGAGCGAAATGCCATTATTGAAGAAGAGCCTATTCTTAACTATGCCAACCTCTGGCAA
GTGTTTCTTGATGAAGTTCCGCAGGCACTGACGTCACAAACCAAAGATCTAGAATACGTGGCATGGCTTA
TCGAAGCGTTAACTCGCCTTGATGGTTTTAAAGGAATGGCGGTTGGCTATGAGCTGGCCACCTACTACTT
AGAAAATTATTGGGCAGATCTGTATCCAATGCCGGATGAAGATGGCCTAGAAACAAGAATTTCGCCCATC
ATCGGCCTGAATGGCATCGATAATGAGGGGACGCTCATTTTTCCGTTATCGTGCATACCCATGACCGAAG
GGCTGTTAGAACAACCTTATGCGTATTGGGAGTATCAACAAGCTTTGGACTTGGAGCGCTGTGATGAGGA
CAAGAAACGAGCCAAACGCGATCAGGGTGTCCCTGAGTTATCTGACATTACCCAAGCCGTCAAATCGTCG
AGCAGTCAGTTCTACCAAAGACTGATAGAGGATCTAAATAGAGCGATAAGTTCTTTTGAACGATTTTCAC
AGGCTTTGGATAGTGCGTGTGAAGAAGTCACCCCAAGTTCCTACATTTCTCGAAAATTAGATGCAATACA
CTCGGCAATTATGCATTTGGCGAGTGACAAAATGATCAAGGTTTCAAAAGAAACGAATTCAGATGAACCA
TCGCACTCTGCTTCTAGTCACGAAGGCGAGATCGATGGACGAGGGCAGGGCGAAGCTAATTTTCAGTTAT
TGGCCGCAAATATGCACTCTCGTGAACAGGCCATAGTGCATTTGCAACGAGTGGCTGATTTTTTTCGTGA
AACAGAACCGCATTCACCCGTTTCATACACGATTGAACAAGTGATTCGATGGTGTGGAATGTCTTTGCCA
GAACTCCTGGCAGAGCTTATTTCCGATGGAGACGCCAAGAAAGGCTATTTCCGTTTGGTTGGCATAGCAG
ACAAAAATGAGTAA
 Primer design