SecReT6
Protein ID: 320158758
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03911
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1076672..1080187 [-]
ProducticmF-related protein
NoteTssM
UniProt IDE8VUR8
KEGG IDvvm:VVMO6_03911
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-89, Aligned region: 57..109
ImcF-related_N [PF14331], Evalue: 1.20E-89, Aligned region: 188..451
ImcF-related_N [PF14331], Evalue: 1.20E-89, Aligned region: 1025..1054
IcmF-related [PF06761], Evalue: 1.40E-81, Aligned region: 501..803
DUF1215 [PF06744], Evalue: 3.20E-36, Aligned region: 917..1033
Protein Sequence: 1171 a.a.     [Download]
>gi|320158758|ref|YP_004191136.1| icmF-related protein [Vibrio vulnificus MO6-24/O]
MAKIKRLLGQKWLISLIGLGAISIFIWFVGPLIAIAGIEPLKSDFNRLLVIVVLVFIWGVTNVVRQQKER
KEQDESIQSLLEVDALTDKEAAAEIDVMRERIEKAIQVVTKGGKRKSHLYQLPWYVLIGPPGTGKTTALK
ESGLEFPLSDSMGVDSVSGIGGTRNCDWWFTNKAVLIDTAGRYTTQDSQAHVDSKAWYGFLGLLKQYRKQ
RPINGAIVTVSIASMLTQTRTERGMHARAIKNRLQELKNQLGMQFPIYVVLTKADLIAGFSEFFTELTKE
EREQLLGFMFPPSTEDERGVISLFNKEFHDLLERLDRRMMQRLETEHDLDKRSLIFEFPKQLRCLQANLD
EFLNDIFAQNKFEESSMIRGVFIVSSLQEGTPVDRIMSETSQGLGLGKPLLRLSSKESSSYFVKNLFENV
IFKEQFLGTVNRHHQKQSGWIRKGVYCSCLALSGAAITLWMMSYQWNNQLIDETDRQVAVVNDLLAKSGL
DFENDLIPSINILNHIMRFPMGYRQQDDERDRVTSFGLFQGEKIGQSAKSAYHQALTNYYSSYVESVLLS
EMKNNEQHREYLYETLKTYLMLFNDDKFEREHVLGWFNYFFERQYPGELNEELREQLYAHTENFLSQADR
GLYINNDSVTAARLVLTEMSLSERAYQRMKLQFLKSHVPSFRLTDVLGARGVEQFERKSGKPLSMGISGF
YTYNGFHSIFQLQLGRMVKALMEENWVYGDEIDAQNIDHDLALQGVRERYYRDYVYEWKTLLNDIQLKAA
PSLKLSLEQSMALAGSERPIESLLKAVQKEVALTKISLSNNEKAAAEVAGKVAKVKFSNTADKLDLYRPE
EGNTFDIALPGKEVEAEFDDLVRMTDQDFDDIHLALSGLKSYLADLSSSGNNQKVAYKSILNGTVTGEVA
ASIEHAKQLLPAPFNNWLGELSEESVKLAEKGSRSHLNTLWVNKVLKPYERSIKGRYPFEPRAKTEVTLK
DFSRFFGYGGTLDAFFVEYLEPFVDTSRSVWRFEKEIGVSQETLAVFQRADRIRQSFFELDNTLKVDFAM
KPIYLDQHITSFVLEVGGQNLAYRHGPARVKNLSWPAKRSATRVVFTPPDSIREIAYTYEGEWGIFKLLD
QSLKARPQSRKDNIVMIDLKGNKVQLELIPKSTMNPFWSSDMESFRCPQTL
 
Nucleotide Sequence: 3516 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1080187-1076672 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGGCAAAGATTAAACGTTTATTGGGGCAAAAATGGCTGATTAGCTTGATCGGGCTTGGGGCAATTTCTA
TTTTTATTTGGTTTGTCGGACCATTGATCGCGATAGCAGGCATAGAGCCACTGAAATCAGACTTTAACCG
TTTGTTGGTTATTGTGGTTTTAGTCTTCATTTGGGGCGTGACGAATGTTGTCCGTCAACAGAAGGAGCGA
AAGGAACAAGATGAAAGCATCCAAAGCCTATTAGAGGTGGATGCCCTGACCGATAAAGAAGCGGCGGCAG
AAATAGACGTCATGCGCGAAAGAATTGAGAAGGCGATTCAAGTCGTGACGAAAGGTGGAAAGCGTAAGAG
TCATCTCTACCAGTTGCCTTGGTATGTACTTATTGGCCCTCCTGGAACAGGTAAAACGACGGCATTAAAA
GAATCGGGTCTCGAGTTTCCTCTATCAGATTCAATGGGTGTTGACTCGGTTTCTGGTATTGGCGGTACGA
GAAATTGTGATTGGTGGTTTACCAATAAAGCGGTGTTGATTGATACGGCTGGCCGGTACACCACGCAAGA
TAGCCAAGCTCATGTCGATTCAAAAGCATGGTATGGATTCTTAGGCTTATTAAAGCAATACCGTAAACAG
CGTCCCATTAATGGTGCGATTGTTACCGTCAGCATCGCCAGTATGCTCACACAAACTCGCACCGAACGAG
GCATGCATGCAAGAGCGATAAAAAATCGGCTACAAGAACTGAAAAATCAATTGGGTATGCAGTTCCCAAT
CTATGTTGTGTTGACGAAGGCTGATCTCATTGCGGGTTTTAGTGAGTTTTTTACGGAACTGACCAAGGAA
GAGCGAGAGCAGTTATTAGGATTTATGTTTCCACCTTCAACAGAAGACGAGCGAGGCGTCATCTCTCTAT
TTAACAAAGAGTTTCATGACTTACTGGAGAGACTTGATCGCCGCATGATGCAAAGGCTTGAAACGGAGCA
TGACCTTGACAAACGATCTTTAATTTTTGAATTTCCAAAACAATTGCGTTGTCTTCAAGCGAATCTAGAC
GAGTTTCTGAACGACATTTTTGCCCAAAACAAGTTTGAAGAATCTTCAATGATTCGCGGCGTCTTTATTG
TTAGCTCACTGCAAGAAGGCACGCCAGTTGATCGTATCATGTCTGAAACATCCCAAGGGCTGGGGTTGGG
CAAACCTCTACTGCGGTTAAGTTCCAAAGAATCAAGCAGCTATTTTGTAAAAAACTTGTTTGAAAACGTC
ATCTTTAAAGAACAGTTTTTGGGGACGGTCAATCGTCATCATCAAAAGCAAAGTGGTTGGATCCGAAAAG
GCGTCTACTGCTCGTGCCTAGCGCTGTCTGGGGCTGCCATCACTCTGTGGATGATGAGTTATCAGTGGAA
CAATCAACTCATTGATGAAACGGATCGTCAAGTAGCTGTGGTGAATGACTTACTTGCTAAGTCTGGTCTG
GACTTCGAAAACGACTTGATCCCCTCGATAAACATTCTCAATCACATCATGCGTTTCCCTATGGGTTATA
GACAGCAAGATGACGAGAGAGATCGTGTGACATCGTTTGGTTTGTTTCAAGGTGAAAAAATTGGCCAATC
GGCTAAGAGTGCTTATCACCAAGCATTGACAAATTACTATTCATCCTATGTTGAATCGGTACTTCTCAGT
GAAATGAAGAACAATGAACAGCACCGAGAATATCTGTACGAAACACTCAAAACATATTTGATGCTCTTCA
ACGATGACAAATTTGAGCGTGAGCATGTTCTTGGTTGGTTCAATTATTTCTTTGAAAGGCAGTATCCCGG
TGAACTGAATGAAGAGTTAAGAGAGCAACTCTACGCTCATACCGAGAACTTTTTGTCGCAGGCAGACAGA
GGCTTATATATCAACAACGATTCAGTAACCGCTGCCAGATTGGTTCTAACAGAAATGTCGTTGTCGGAAA
GAGCCTACCAAAGAATGAAACTGCAGTTCCTTAAAAGTCATGTGCCTTCATTTCGTTTAACGGACGTTCT
AGGGGCTAGGGGAGTTGAGCAGTTTGAGCGAAAAAGTGGCAAGCCATTATCGATGGGGATTTCCGGTTTC
TACACGTACAACGGTTTTCATAGCATCTTCCAATTGCAACTGGGTCGTATGGTAAAAGCCTTGATGGAAG
AAAACTGGGTGTATGGGGATGAGATCGACGCCCAAAACATCGACCATGATCTCGCTTTGCAAGGTGTGAG
AGAGCGCTACTATCGTGACTATGTCTATGAATGGAAGACACTGCTCAATGACATCCAACTCAAAGCGGCA
CCAAGTTTGAAACTAAGTTTAGAGCAGAGTATGGCATTAGCGGGCTCTGAGCGACCAATTGAATCGCTGC
TTAAAGCGGTACAAAAAGAGGTGGCATTAACGAAAATTTCGCTAAGCAACAACGAAAAAGCGGCAGCTGA
AGTCGCTGGCAAAGTTGCCAAAGTGAAATTTTCAAATACGGCGGACAAACTTGATTTATATCGTCCGGAA
GAGGGCAATACGTTTGATATTGCGCTTCCTGGAAAAGAAGTGGAAGCCGAGTTTGATGATCTTGTTAGGA
TGACAGACCAAGACTTTGACGATATTCATCTTGCACTGAGCGGTTTAAAAAGTTATTTGGCCGATCTCTC
TAGCTCAGGAAACAATCAGAAAGTCGCCTACAAGAGCATCTTAAATGGCACCGTGACAGGAGAAGTTGCC
GCGTCAATTGAACATGCTAAACAGCTTTTACCCGCTCCGTTTAACAACTGGCTAGGTGAACTTTCCGAGG
AATCGGTCAAGTTAGCGGAAAAAGGATCGCGATCTCACCTTAATACGCTATGGGTTAACAAGGTTCTTAA
ACCTTATGAGCGCAGCATCAAAGGTAGGTATCCCTTTGAGCCAAGAGCGAAAACAGAAGTGACGTTAAAG
GACTTCAGTCGATTCTTTGGCTATGGCGGAACACTTGATGCGTTCTTTGTCGAATACTTGGAACCGTTTG
TCGATACGTCGAGAAGTGTGTGGCGCTTCGAGAAGGAAATCGGTGTCAGTCAAGAAACACTCGCCGTATT
TCAACGCGCAGATCGCATCCGACAGTCATTTTTTGAACTCGACAATACATTAAAAGTCGATTTTGCAATG
AAACCGATATACCTAGACCAACATATAACCAGCTTTGTACTGGAAGTTGGGGGGCAGAATCTTGCATACC
GACATGGGCCAGCAAGAGTAAAAAATCTCTCTTGGCCAGCTAAGCGTTCAGCAACAAGAGTGGTTTTCAC
ACCACCCGATTCGATTCGTGAAATTGCTTATACCTATGAAGGTGAATGGGGCATTTTTAAGTTGCTTGAT
CAATCTCTGAAAGCAAGGCCGCAATCTCGCAAAGACAACATCGTCATGATTGATTTGAAAGGCAACAAAG
TTCAACTGGAATTGATTCCTAAGAGTACGATGAACCCATTTTGGTCGAGTGATATGGAGAGTTTCCGATG
TCCGCAAACGCTATAA
 Primer design