SecReT6
Protein ID: 320158759
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03912
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1080174..1081502 [-]
Productouter membrane protein ImpK/VasF, OmpA/MotB domain
NoteTssL
UniProt IDE8VUR9
KEGG IDvvm:VVMO6_03912
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.50E-62, Aligned region: 50..255
OmpA [PF00691], Evalue: 4.30E-14, Aligned region: 323..421
Protein Sequence: 442 a.a.     [Download]
>gi|320158759|ref|YP_004191137.1| outer membrane protein ImpK/VasF, OmpA/MotB domain [Vibrio vulnificus MO6-24/O]
MDETIVKPTPGRKKAPQSTPVASLESDNTVLFTQNSKETRETSIVAFGNNVLLAEANVIVSLLGQIRATA
THSDVKQLREAFVQKMRDYENRLRLQGANSKRIDIARYCLCCAIDEAVLNTEWGSQSVWGHNSLLSTFYS
NTQGGEQFFIHLDESLAEPNKHLDLLEVMYICMSLGFLGQFRVRENGIEQHRSLKNRVMDVLKSHGRDYS
PSLNDDALAKVLVGEQIAEKAPLWVVLSITAAVLASVYMYLSYSLNEKSDQTFSQLMNLVPSKEIENQSA
DYISSLAVANQIQRSLATEIEMGLLKVDALPDRVRITFQSNDLFESGSAELVAHIFPVVSKVARALEATN
GKILVVGHTDNNPIFTSKFPSNWHLSLARATALTDRLASAGKLSGRVIPEGMGEARPLVSNETAEGRSIN
RRVEIDLLVQTQSKMDANNGKD
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1081502-1080174 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGGACGAAACGATTGTAAAACCAACCCCTGGGCGTAAAAAAGCACCGCAGTCGACACCTGTTGCATCGC
TTGAAAGCGATAACACGGTTCTCTTTACGCAAAATAGTAAAGAAACGCGTGAAACGAGTATCGTCGCGTT
TGGCAATAACGTACTGCTGGCAGAAGCGAATGTCATTGTTTCCTTGCTTGGCCAAATTAGAGCGACGGCC
ACGCACAGTGATGTCAAACAGTTACGTGAAGCATTTGTGCAAAAAATGCGTGACTATGAAAACCGGTTGA
GATTACAAGGCGCAAATAGTAAGCGGATCGATATCGCACGCTACTGTTTATGTTGTGCTATCGATGAAGC
CGTCCTAAATACCGAATGGGGAAGTCAATCCGTTTGGGGACACAACTCGTTATTGTCGACATTCTATTCC
AATACTCAAGGCGGTGAGCAGTTCTTCATACATCTCGATGAAAGCCTTGCCGAACCCAATAAGCACTTAG
ATCTGCTAGAAGTCATGTATATCTGCATGAGCTTAGGTTTTTTGGGGCAATTTCGAGTTCGAGAAAATGG
AATCGAGCAACATCGTTCCTTAAAAAACCGCGTAATGGATGTCCTTAAATCGCACGGTCGGGACTACAGT
CCTTCACTCAACGATGATGCGTTAGCCAAAGTATTGGTTGGTGAGCAGATCGCAGAAAAAGCACCATTGT
GGGTTGTTTTATCAATTACCGCAGCTGTGTTAGCCAGTGTGTACATGTACTTAAGTTATAGCCTAAACGA
AAAATCCGATCAGACCTTTAGTCAGTTAATGAACTTAGTGCCGAGCAAAGAGATAGAGAACCAGAGTGCG
GATTATATTTCATCTCTTGCCGTAGCAAATCAAATCCAACGTTCGTTGGCAACGGAAATAGAAATGGGTT
TACTAAAAGTCGATGCATTACCCGATAGAGTGCGTATTACTTTTCAGTCCAATGATCTGTTTGAATCGGG
CAGTGCGGAGCTTGTCGCGCATATATTCCCTGTGGTTTCGAAAGTGGCCAGAGCACTCGAGGCGACCAAT
GGAAAAATATTGGTTGTCGGACATACCGATAATAACCCCATTTTTACCAGTAAATTCCCTTCTAACTGGC
ATTTATCTCTCGCCAGAGCGACAGCGCTTACCGATCGCTTAGCATCAGCAGGCAAATTGAGTGGGCGTGT
CATTCCAGAAGGAATGGGAGAGGCGAGACCTTTGGTATCAAATGAAACCGCAGAAGGAAGAAGCATCAAC
CGTAGAGTCGAAATCGATCTCCTAGTTCAAACCCAATCAAAAATGGATGCAAACAATGGCAAAGATTAA
 Primer design