SecReT6
Protein ID: 320158760
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03913
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1081511..1082833 [-]
Producthypothetical protein
NoteTssK
UniProt IDE8VUS0
KEGG IDvvm:VVMO6_03913
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-139, Aligned region: 19..438
Protein Sequence: 440 a.a.     [Download]
>gi|320158760|ref|YP_004191138.1| hypothetical protein VVMO6_03913 [Vibrio vulnificus MO6-24/O]
MSVYSPIVWSEGMFLRPQHFQQQERALSHEYKGLTRLVGCYARGIESFSLDKEQLKEGVVSLTECVGIFS
DMTFVNIPIKEQLPEPLKIDPGIENTLVQLVIPAEKSQGQNVSHSETSMVTRYKVVDHTLTDSVSGDEEV
LQLAALKCELKATNDNLPGYVSLPLVKIRHVGSEGQVILDEEFVPPFLNVHHSSLLTRYLNNVLAMIKIR
ADAIASRLGQGKSASSSAVDFIMLQMLNRYEANLRHLSKGSELHPHELATALLSLIGELSTFSSKNKRVP
KLPEYQHSNLGSVFSEMNQILSQYLSVVLEQTATKMPLDIRQFGIRVTPLPDKSLLSLCQFVLAVKADVS
ADEIRKKLPGQIKVGPAENIRDLINNQINGIAVSPLNVVPRQMPYAAGYVYFELVKQGAYWARLNESGGM
AFHVSGNYPGLEMELWSINQ
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1082833-1081511 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGAGTGTTTATTCACCGATTGTTTGGAGTGAAGGGATGTTTCTGCGTCCTCAACACTTTCAGCAACAAG
AGCGAGCGTTGTCTCATGAATACAAAGGTCTAACGCGTTTAGTGGGGTGTTATGCCCGAGGAATTGAATC
GTTTTCTCTCGACAAAGAACAGTTGAAAGAAGGGGTTGTATCGCTAACTGAGTGTGTTGGAATTTTCTCC
GATATGACATTCGTTAACATACCTATTAAAGAGCAGCTTCCTGAGCCACTCAAAATTGATCCAGGGATTG
AAAATACTTTGGTTCAGCTTGTGATACCTGCAGAAAAATCCCAAGGCCAAAACGTTTCCCATTCCGAGAC
TTCAATGGTAACGCGCTATAAGGTGGTTGATCACACCTTAACCGATAGCGTATCTGGTGATGAAGAAGTA
CTTCAACTCGCTGCGCTTAAGTGCGAGTTAAAGGCAACCAATGACAATTTGCCGGGCTATGTCTCTTTGC
CACTGGTGAAAATTCGTCATGTTGGTAGCGAAGGTCAAGTCATTCTTGATGAAGAGTTCGTACCACCTTT
CCTTAATGTCCACCATAGTTCGCTGCTTACTCGTTATTTGAATAACGTTTTAGCCATGATCAAAATTAGG
GCAGACGCCATTGCAAGTCGTCTCGGACAAGGCAAGTCAGCGTCTTCCTCTGCAGTAGATTTCATTATGC
TACAAATGCTGAATCGTTATGAGGCTAACTTAAGACATTTATCGAAAGGGAGTGAGCTTCATCCACATGA
GTTAGCGACGGCCTTATTGAGCTTAATTGGTGAGCTGTCCACTTTCTCGAGTAAAAATAAGCGAGTCCCT
AAGCTTCCCGAATACCAACACAGTAATTTGGGGTCTGTCTTTTCTGAGATGAATCAAATCCTCAGTCAAT
ATCTGAGTGTGGTATTGGAGCAAACTGCGACCAAGATGCCCTTGGATATTCGTCAGTTTGGGATTCGCGT
TACGCCATTACCAGATAAAAGTTTGCTTTCACTTTGTCAGTTTGTATTGGCCGTTAAGGCCGATGTCTCT
GCCGATGAAATTAGAAAAAAGTTACCAGGACAAATCAAAGTTGGACCCGCAGAGAATATTCGCGACCTTA
TCAATAATCAGATCAACGGTATTGCCGTTTCGCCACTGAATGTGGTGCCAAGACAGATGCCTTACGCAGC
AGGCTACGTCTATTTTGAGCTGGTTAAACAAGGCGCTTATTGGGCTCGTTTAAATGAAAGCGGGGGAATG
GCATTTCATGTCTCTGGTAATTACCCAGGGTTAGAAATGGAGCTTTGGAGTATTAACCAATAA
 Primer design