SecReT6
Protein ID: 320158761
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03914
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1082857..1083312 [-]
Producttype VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDE8VUS1
KEGG IDvvm:VVMO6_03914
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.70E-37, Aligned region: 14..147
Protein Sequence: 151 a.a.     [Download]
>gi|320158761|ref|YP_004191139.1| type VI secretion lipoprotein/VasD [Vibrio vulnificus MO6-24/O]
MKAMAKIITTIIVFLLVGCSAANMVVSPYSNLEIKTGFNVNPDMNGRPSPVVVYVLELTSDTLFTSQDFF
SLYENTAQTLGPDLVNKTELYLSPGQKTLYESTMKPSVEYIGIVVAYRDIENANWRKVIKVDRKGYNTYE
LSLDELSLAIK
 
Nucleotide Sequence: 456 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1083312-1082857 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGAAAGCCATGGCAAAAATAATTACCACAATAATAGTGTTTTTATTAGTGGGTTGCAGTGCGGCAAATA
TGGTTGTTTCTCCCTATTCAAATTTGGAAATAAAGACGGGGTTCAATGTCAATCCAGATATGAATGGCAG
ACCTTCACCTGTCGTAGTTTATGTCCTTGAACTCACTTCTGATACCTTATTTACGAGTCAAGACTTCTTT
TCTCTATATGAAAATACAGCCCAAACGCTAGGTCCGGATCTGGTGAACAAAACAGAATTGTATCTCTCCC
CAGGCCAAAAAACACTTTATGAATCTACGATGAAACCAAGTGTTGAATATATCGGCATTGTAGTGGCATA
TCGAGACATCGAAAATGCAAATTGGCGCAAGGTGATAAAGGTCGACCGCAAGGGCTATAATACCTACGAG
CTTTCACTAGATGAATTGTCTTTGGCTATAAAATAA
 Primer design