SecReT6
Protein ID: 320158762
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03915
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1083313..1084524 [-]
Producthypothetical protein
NoteFha
UniProt IDE8VUS2
KEGG IDvvm:VVMO6_03915
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.50E-16, Aligned region: 33..101
FHA [PF00498], Evalue: 2.50E-16, Aligned region: 376..393
Protein Sequence: 403 a.a.     [Download]
>gi|320158762|ref|YP_004191140.1| hypothetical protein VVMO6_03915 [Vibrio vulnificus MO6-24/O]
MGIVLSITSFHRFTPEIKSVYSIPTNEEHFCMKFGRSESCDWVLPDPERIISGVHGEITKFGNDYLLRDL
STNGIFVNKSVSPVGNGVEVALNDKDVINFGDYEIEVSFKNSENHNVTQSHTNTLSPREVNKDPVSGNDN
FMDFGFDANLFLAEEEKQQQNLSPELGDLDDFLDAPILSPHIEPTLKEERATDYPRDEKVAKRCERVDSD
LNAFLNGAGIDLSLVPEQEREQWFNRLGRSYSLMLEGLMQTLHNRAEFKQANKLNHTSFQKKENNPLKFS
ANLEDAIHNLYNRRSASFLSPEAAIQSAFNDIEAHEKAMIEGVHGAVSGVLRLLEPNTISGHVSQSEKNG
LTSIFSQLDKKRWKKYENIYFQIRNEIDIDEKGFYLEDFSKSYESAIRKVGRE
 
Nucleotide Sequence: 1212 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1084524-1083313 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGGGAATAGTGCTTTCGATTACTAGTTTCCACCGTTTTACACCAGAAATAAAAAGTGTGTATTCAATAC
CCACCAATGAAGAACACTTTTGTATGAAATTTGGTCGCTCTGAGAGCTGTGATTGGGTATTACCTGATCC
TGAACGAATTATTTCTGGTGTTCATGGTGAAATAACTAAGTTTGGTAATGATTATCTACTTAGAGATCTC
TCTACAAATGGTATTTTTGTTAATAAGTCAGTCAGCCCAGTAGGAAATGGTGTCGAGGTGGCTTTAAATG
ACAAAGATGTGATTAATTTTGGAGATTATGAAATCGAAGTATCATTTAAAAATAGTGAAAACCATAACGT
AACCCAAAGCCACACCAATACTCTGTCACCACGTGAAGTAAATAAAGATCCTGTCAGTGGTAATGACAAT
TTTATGGATTTTGGTTTTGATGCAAACCTATTTTTGGCAGAAGAAGAAAAGCAGCAGCAAAATCTGTCGC
CAGAGCTAGGTGATTTGGATGACTTTCTTGATGCTCCCATATTAAGCCCTCACATAGAGCCGACTTTGAA
AGAAGAGAGAGCAACCGACTATCCTCGTGATGAGAAAGTGGCTAAGCGATGTGAGCGTGTTGACTCGGAT
TTGAATGCCTTTCTCAACGGGGCTGGCATCGATTTAAGCTTAGTTCCAGAACAGGAAAGAGAGCAATGGT
TTAATCGATTAGGTCGCTCTTACTCTCTTATGTTAGAAGGTCTGATGCAGACACTGCATAATCGTGCAGA
ATTTAAACAGGCGAACAAATTAAACCATACCTCTTTTCAGAAAAAGGAAAATAATCCTCTTAAGTTTTCG
GCGAATTTAGAAGATGCAATTCACAATCTATATAACAGACGCAGTGCGAGTTTTCTCTCACCGGAAGCTG
CAATTCAATCTGCATTCAATGATATAGAAGCTCATGAAAAAGCAATGATAGAAGGTGTTCATGGTGCTGT
ATCTGGGGTGTTACGACTGCTTGAGCCGAATACCATATCCGGACATGTGTCTCAAAGTGAAAAAAATGGA
TTGACATCAATATTTTCGCAACTCGATAAAAAACGATGGAAGAAGTATGAAAATATCTATTTTCAAATAA
GAAATGAAATTGACATTGATGAGAAAGGGTTTTATTTGGAAGACTTTTCCAAATCTTATGAATCGGCAAT
AAGAAAAGTAGGGAGAGAATAA
 Primer design