SecReT6
Protein ID: 322420529
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3033
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3597030..3600479 [-]
Producthypothetical protein
NoteTssM
UniProt IDE8WHS6
KEGG IDgeb:GM18_3033
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.00E-52, Aligned region: 183..429
IcmF-related [PF06761], Evalue: 0.00047, Aligned region: 474..550
AAA_16 [PF13191], Evalue: 0.00092, Aligned region: 113..162
AAA_16 [PF13191], Evalue: 0.00092, Aligned region: 614..640
AAA_16 [PF13191], Evalue: 0.00092, Aligned region: 826..878
Protein Sequence: 1149 a.a.     [Download]
>gi|322420529|ref|YP_004199752.1| hypothetical protein GM18_3033 [Geobacter sp. M18]
MKQNVLTYCKYALFGAALFPTLVIAFVMIQLLPWPWRVGIFLPFIVLLLWGVLESLKKLLRKNADKPQPV
RQEPVAVEPQLAEPMRQDRLHDLQQSWRTAVRVLKTSHLKKEGDPLHVLPWYLVLGASGSGKTSAVRGAR
LLSPFAQGQGETTATANCDWHFYDEGIVIDTAGRYAVPLDPGSDHEEWRTFLSLLKKYRRTELINGVILT
VSADRLAGGDSQELEDQGRQLRCRMDEMIRFLGINFPAYLLITKCDLISGMSEFCALLPPESLDQPMGLL
NQELDREAPRFLDRLSAFVDERLRMLRLLLLHRGSATPPGGRLLLFPDRLRALRPGLDLFMQAAFAENHY
QETPLLRGIYLCSARRPTPTQAAVQDRVVAPGGGHVAAAAHGVFIHDFFEKVLPRDRGLWTPSARTLKWR
HLSGNLALVCWLLLGTSLCVLLTCAFAKNMTVMREAAVLSVVAPQLQGDVAVDLPALEKMRRAILDLEHE
NRNWWTPRFGLTRSMEVEQTLKARYCTAYQKHLLAPFDGRMAAPLEALSPAIPDQAFGALVLHLSRRCNL
LKARRAGDDLAALSARPLPQYQVLASQPEEWSNPVCGSLYLCYVAWRTDTGELSRELQRLQSLLKRLVQL
KGANLTWLIGYVDREQATAAISLQDFWSGSRPLSGEPTVAPSFTRRGRERIASLLEELCAAYPDRGVLER
ERGEFLRGYREVTFAAWRHFAAQLPKGEQRLIAPGEWQSAAAGMAGEQGPYFSFMRRALSELQPFDTAEP
LPAWIAELYRFQALKRGGPAGVASSLSRQASRLAGTIGGLGGKKESLAGSDPGVNLAREYLNAVAQIAPV
AKSRASAHRMALQAFSDSGEAGKSPLFLAAETAQRLNRLLAQGQGDDTFARLIYGPISFYGTYIRMETAC
TLQAQWEQRVLKEVQGSSDAQTLQYLLGKDGPVWKYVGDYANPFIGWSPARGYYPKSALGGSIPFKPEFY
SFLAQGGRAKLAAAAGAPKPVYQVTIKGLPTDANAEALKPQGTRLELHCATGPQVIANMNYPVSKPFIWT
PETCSDVVLQIEIGDTVLTRRYPGSSGFADFLRDFPAGRHTFHPRNFPHEKEALERMGVRFIKVNYQMSG
AGDITSKQAESLPARIPVKIAECWDQGEP
 
Nucleotide Sequence: 3450 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3600479-3597030 Geobacter sp. M18 chromosome, complete genome
GTGAAGCAAAACGTGCTCACCTATTGCAAATACGCGCTGTTCGGCGCGGCGCTTTTCCCGACGCTGGTGA
TCGCCTTCGTGATGATCCAGCTCCTGCCCTGGCCCTGGCGCGTAGGCATCTTCCTCCCTTTCATCGTGCT
GCTGCTTTGGGGGGTGCTTGAATCGCTCAAGAAGCTGCTTCGGAAAAACGCTGACAAGCCGCAACCGGTG
CGGCAGGAACCGGTTGCGGTGGAACCGCAGCTTGCGGAGCCGATGCGACAGGATCGGCTCCACGATCTGC
AGCAGAGCTGGCGGACGGCGGTCCGCGTGTTGAAGACGTCGCATCTCAAAAAGGAGGGGGACCCGCTGCA
CGTCCTCCCGTGGTACCTGGTGCTGGGTGCGAGCGGTTCGGGTAAGACCTCTGCGGTGCGGGGCGCCCGC
CTCCTGTCACCTTTTGCGCAGGGACAAGGCGAGACGACGGCGACAGCAAACTGCGATTGGCACTTCTATG
ACGAGGGGATCGTGATCGACACGGCGGGGCGCTACGCCGTGCCGCTGGACCCCGGCTCCGACCACGAGGA
GTGGCGCACCTTTCTCTCCCTGCTGAAGAAATACCGCAGGACCGAGTTGATCAACGGCGTCATCCTTACG
GTGTCGGCCGACCGGCTCGCCGGCGGCGACTCGCAGGAACTGGAGGACCAGGGGCGGCAGCTGCGCTGCC
GCATGGACGAGATGATCCGCTTTCTCGGCATCAACTTTCCTGCCTACCTGCTCATCACCAAGTGTGATCT
CATCAGCGGCATGAGCGAGTTCTGCGCCCTGCTCCCCCCTGAGAGCCTCGACCAGCCGATGGGGCTTTTG
AACCAGGAGCTGGACCGGGAAGCGCCGCGCTTTCTCGATCGTCTTTCGGCCTTTGTTGATGAGCGGTTGA
GGATGCTGCGCCTTTTGCTGCTGCATCGCGGTTCAGCCACGCCACCGGGCGGGCGCCTGCTGCTCTTCCC
CGATCGACTGAGGGCGCTGCGCCCCGGCCTCGACCTCTTCATGCAGGCCGCGTTTGCCGAGAACCATTAC
CAGGAGACCCCGCTTTTGCGCGGCATCTACCTGTGCAGCGCCCGTCGGCCGACCCCGACGCAGGCAGCTG
TGCAAGACCGCGTCGTCGCTCCAGGCGGGGGGCACGTTGCCGCTGCGGCTCACGGTGTTTTCATCCACGA
TTTCTTCGAGAAGGTCCTGCCGCGAGACCGCGGGCTTTGGACCCCCAGCGCCCGGACCCTCAAGTGGCGG
CACCTCTCCGGCAACCTTGCCCTGGTCTGCTGGCTCCTGCTCGGGACCTCGCTCTGCGTTCTGCTCACCT
GCGCGTTCGCGAAGAACATGACGGTGATGCGGGAAGCGGCTGTGCTTTCCGTCGTTGCGCCGCAACTGCA
AGGGGATGTGGCGGTCGATCTTCCCGCCCTGGAAAAGATGCGCCGCGCCATCCTCGACCTGGAGCATGAG
AACCGGAACTGGTGGACGCCCCGGTTTGGGCTGACCCGCAGCATGGAGGTGGAGCAGACCCTGAAGGCGC
GCTATTGCACTGCATACCAAAAGCACCTGCTGGCTCCGTTCGACGGCAGAATGGCAGCCCCCCTCGAAGC
GCTCTCCCCCGCCATACCGGACCAGGCTTTCGGGGCTTTGGTCCTGCACCTGAGCCGGCGCTGCAACCTT
CTTAAAGCGCGCCGGGCCGGAGATGATCTCGCTGCGCTCTCCGCGCGCCCCCTTCCGCAATACCAGGTGC
TGGCATCCCAGCCTGAGGAGTGGTCGAATCCCGTCTGCGGAAGCCTTTATCTCTGCTATGTCGCCTGGCG
TACCGATACCGGCGAGCTGTCCCGGGAATTGCAGCGGCTGCAATCGTTGCTGAAGCGCCTTGTCCAACTG
AAGGGGGCGAATCTGACCTGGCTGATCGGTTACGTCGACCGGGAGCAAGCCACAGCCGCCATCTCGCTGC
AGGATTTTTGGAGCGGCTCACGGCCGTTGTCGGGCGAGCCCACAGTTGCGCCATCGTTCACCCGCAGGGG
AAGGGAGCGCATCGCCTCCTTGCTTGAGGAGCTGTGCGCGGCGTACCCGGACCGGGGCGTCCTGGAGCGG
GAGAGGGGGGAGTTCCTGCGCGGGTACCGCGAGGTCACCTTTGCCGCCTGGCGGCATTTTGCGGCACAGT
TGCCAAAGGGGGAGCAGCGGCTTATCGCCCCCGGGGAGTGGCAAAGTGCGGCGGCCGGCATGGCGGGGGA
GCAGGGGCCATACTTCAGCTTCATGCGCCGCGCCCTGTCAGAGCTGCAACCGTTCGACACAGCAGAGCCC
TTGCCGGCATGGATCGCCGAACTATACCGCTTCCAGGCGCTGAAGAGGGGAGGTCCGGCAGGCGTCGCCT
CCTCGCTTTCGCGGCAGGCCAGCCGGTTGGCCGGGACCATCGGGGGGCTCGGGGGCAAAAAGGAGAGCCT
CGCCGGCAGCGATCCCGGTGTGAACCTGGCCAGAGAGTACCTGAACGCCGTGGCGCAGATAGCGCCGGTG
GCGAAATCAAGGGCATCGGCACACCGGATGGCGCTGCAGGCCTTCAGCGACTCCGGCGAAGCCGGCAAGT
CCCCCCTTTTCCTGGCGGCTGAGACCGCACAGAGGCTGAACCGGCTCCTGGCGCAGGGACAGGGGGACGA
TACCTTTGCCCGTCTCATCTACGGCCCCATAAGCTTCTACGGCACCTACATCCGCATGGAGACCGCCTGC
ACGCTTCAGGCGCAGTGGGAACAAAGGGTGCTGAAGGAGGTGCAGGGGAGCAGCGACGCACAGACCCTGC
AGTATCTGCTGGGCAAGGACGGACCGGTCTGGAAGTACGTCGGCGACTACGCCAACCCCTTTATCGGCTG
GAGCCCCGCACGCGGGTACTACCCCAAGTCCGCCCTCGGCGGCTCGATTCCGTTCAAGCCGGAGTTCTAT
TCGTTCCTCGCCCAAGGGGGGAGGGCAAAACTTGCCGCAGCAGCCGGTGCGCCGAAGCCGGTGTACCAGG
TGACCATCAAGGGGCTTCCGACCGATGCCAATGCGGAAGCCCTCAAGCCGCAGGGGACCCGTCTGGAGCT
CCACTGCGCGACGGGCCCTCAGGTCATTGCCAACATGAACTACCCGGTGAGCAAGCCTTTCATATGGACG
CCGGAGACCTGCAGCGACGTCGTCCTCCAAATCGAGATAGGCGACACCGTTCTCACCAGGAGATACCCAG
GCAGTAGCGGCTTCGCCGATTTCCTGCGCGATTTCCCGGCCGGCCGGCACACCTTTCACCCGCGCAATTT
TCCGCACGAAAAAGAGGCGCTGGAGCGGATGGGGGTACGGTTCATCAAGGTCAACTACCAGATGTCCGGC
GCAGGCGACATCACCTCGAAGCAGGCAGAGTCGCTGCCCGCAAGGATCCCGGTGAAGATCGCGGAGTGCT
GGGACCAGGGGGAGCCATGA
 Primer design