SecReT6
Protein ID: 322432876
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4011
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]30743..34129 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDE8X5S3
KEGG IDacm:AciX9_4011
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.30E-37, Aligned region: 496..801
ImcF-related_N [PF14331], Evalue: 1.50E-31, Aligned region: 186..452
DUF1215 [PF06744], Evalue: 2.50E-07, Aligned region: 904..987
Protein Sequence: 1128 a.a.     [Download]
>gi|322432876|ref|YP_004210125.1| ImcF domain-containing protein [Granulicella tundricola MP5ACTX9]
MKRIWLVVLGFVLYLALVIGVGFLLHLPTQRTVLFIVILGLLGAAACAVIIWYLNKISPAGEPANAADQS
NLDSLIKDADNKLKQANRPGIKSLAQLPLIYVIGDENSAKTQTILQSGLDPELLAGQVYRDQSIVPTQSI
NIWLTGSAAVVEASGALLRQPGLWQRLVKLTAPGKVSAALSKSALQPTRAVVLCVSIERILAPSTSEQIR
ALAQSMNERLRQISQSLGISLPVYVLFTKLDTVTAFAEYAANLTEAEVTTPLGSMLAETGAAGAGLYADR
AAQQIGQRFDEVAYLLSEFRLELLARGGQPQTLARSYEFPRDLRKIRPGIVDFLVEVARPTQIGVNPYLR
GFFFSGMRAHIVEDVLSVGAQHSAPIVDPNAGATKIFSIAAMQQQAAPTPVRSSSTRKVAQWVFLPYFFS
RLVLTDKTALESSRSSTRVSGVKRFLAACVCALFAVYLVLLTISFFNNRSLENRAAAATRDIHPVGKSDV
ASVADLQSLEELRQVLVELDGYHKDGAPLMDRWGIYRGEDIHIAACHAWGDRFNKLLLTQTQNNITTKLA
ALPVKALPTDEYQATYKPLKAWLITTSNPDKSTTDFLPPVLFSEWVAARSVTAETGALAENQFEYYAGVL
PEPNSCLARLGGKPDQTLIANTRGYLNSFAGMDHVYLSMKAAADRKFQPIEFKKLYPGSVRIVSAPTIVD
GSFSKDGFTFMQDAINHPDQYLSGEEWVTGPVTAPIDRGHLRDQLSERYQTDFLGAWRTFIKTSQVNGFG
GLEDAANRLHELDGPASPVLQVLGLVSRNTSVSIPAFSQPFQMPQAIVKTDTAPTNSGYTEKLTAIEQAL
RQMISAPGTPDPSGVNSAAGTAETAVNGMRGSFDPAGVVDTSAERLLREPITYVGGIAGKAGGKAANKEG
GDFCAAAKTVLDKFPFNPDAKLDATPEEVATFFSPTGPIGVFVASQSKFIAYNGTLYSAVPGTQVNPALL
NFLNATKSVAAILLPNGATTPSLNFSITQEATPSLTAATLDVDGTSYSTVGTSSHITWQYRVQGSVKLAG
SGQTKNSFGPWSIFHFAYAAKHPAPNKLEYIFQNNGITEKSQTGVDIIYNFDLDENGAKLLNPDYMRHSM
HCVSTVTK
 
Nucleotide Sequence: 3387 bp     [Download]
>gi|322432858|ref|NC_015057.1|:30743-34129 Granulicella tundricola plasmid pACIX901, complete sequence
GTGAAACGCATCTGGCTCGTCGTCCTCGGCTTCGTCCTCTATCTCGCCCTCGTCATCGGCGTAGGCTTCC
TCCTGCATCTCCCCACCCAGCGCACCGTCCTCTTCATCGTCATCCTTGGCCTCCTCGGAGCCGCCGCCTG
CGCCGTCATCATCTGGTACCTCAACAAGATCTCCCCCGCCGGCGAACCCGCCAACGCAGCCGATCAGTCC
AACCTTGACTCACTCATCAAGGACGCAGACAACAAGCTCAAGCAGGCCAATCGCCCCGGCATCAAGTCCC
TCGCCCAGCTTCCCCTCATCTACGTCATCGGCGACGAAAACTCCGCCAAAACCCAGACCATCCTCCAGTC
CGGCCTCGACCCCGAACTCCTCGCCGGCCAGGTCTACCGCGATCAATCCATCGTCCCCACCCAGAGCATC
AACATCTGGCTCACCGGCTCCGCGGCCGTCGTAGAGGCCTCCGGCGCACTCCTCCGCCAGCCCGGTCTCT
GGCAGCGCCTCGTCAAGCTCACCGCTCCCGGCAAGGTCTCCGCAGCCCTCTCCAAATCCGCCCTCCAGCC
CACCCGCGCCGTTGTCCTCTGCGTCTCCATCGAGCGCATCCTCGCCCCCAGCACCTCGGAGCAGATTCGC
GCCCTCGCTCAGTCCATGAACGAGCGCCTCCGCCAGATCTCGCAATCCCTCGGCATCTCTCTCCCCGTCT
ACGTCCTCTTCACCAAGCTGGACACCGTCACCGCCTTCGCAGAGTACGCAGCCAATCTCACCGAAGCCGA
AGTCACCACGCCCCTCGGCTCCATGCTCGCTGAAACCGGTGCCGCAGGTGCTGGCCTCTATGCAGATCGC
GCCGCCCAGCAAATCGGCCAGCGCTTCGACGAGGTCGCCTACCTGCTCTCGGAGTTCCGCCTCGAGCTCC
TCGCACGCGGCGGCCAACCCCAAACCCTCGCCCGCTCGTATGAGTTCCCACGCGACCTCCGCAAGATCCG
CCCCGGCATCGTGGACTTCCTCGTAGAGGTCGCACGCCCCACCCAGATCGGCGTCAACCCCTACCTGCGC
GGTTTCTTCTTCTCAGGCATGCGCGCCCACATCGTGGAGGACGTCCTCTCCGTCGGCGCACAGCATTCAG
CACCCATTGTCGATCCCAACGCCGGCGCCACCAAGATCTTCTCCATCGCCGCCATGCAGCAGCAGGCCGC
GCCCACACCCGTCCGCTCCTCCTCAACCCGCAAGGTAGCCCAGTGGGTCTTCCTGCCGTACTTCTTCTCC
CGCCTCGTCCTCACGGACAAGACCGCGCTCGAATCCAGTCGCTCCAGCACCCGTGTCTCCGGTGTAAAGC
GCTTCCTCGCCGCCTGCGTCTGCGCTCTCTTCGCCGTCTACCTCGTCCTCCTCACCATCTCCTTCTTCAA
CAACCGCAGTCTGGAAAATCGCGCTGCGGCCGCCACCCGTGACATCCATCCCGTCGGCAAATCCGACGTA
GCCTCCGTCGCTGACCTGCAGTCTCTCGAAGAACTCCGCCAGGTCCTCGTTGAACTCGACGGCTACCACA
AGGACGGCGCGCCCCTCATGGATCGCTGGGGCATCTATCGCGGCGAGGACATCCACATCGCCGCCTGTCA
TGCCTGGGGTGACCGCTTCAACAAACTTCTCCTCACCCAGACCCAGAACAACATCACTACCAAGCTCGCC
GCCCTGCCCGTCAAAGCGCTCCCCACGGACGAGTATCAGGCTACATACAAGCCCCTCAAGGCATGGCTCA
TCACCACCTCCAACCCGGACAAGAGCACCACGGACTTCCTACCGCCCGTCCTCTTCTCAGAGTGGGTCGC
CGCCCGCTCCGTCACCGCCGAAACCGGAGCGCTCGCTGAAAATCAGTTCGAGTACTACGCCGGCGTCCTC
CCTGAGCCCAACTCCTGCCTCGCCCGCCTCGGCGGCAAACCCGACCAGACCCTCATCGCCAACACCCGCG
GCTATCTCAACTCCTTTGCCGGCATGGATCATGTCTACCTCAGCATGAAGGCCGCCGCCGACCGCAAGTT
CCAGCCCATCGAGTTCAAGAAGCTCTACCCCGGCTCCGTCCGCATCGTCAGCGCACCCACCATCGTTGAC
GGCTCCTTCTCCAAGGATGGCTTCACCTTCATGCAGGACGCCATCAACCACCCGGATCAGTACCTCTCCG
GAGAAGAGTGGGTCACCGGACCAGTCACCGCGCCCATCGATCGCGGCCACCTCCGTGACCAGCTCTCCGA
GCGTTACCAGACCGACTTCCTCGGTGCTTGGCGCACCTTCATCAAGACCTCTCAGGTCAACGGCTTCGGC
GGCCTGGAAGACGCTGCCAACCGCCTCCATGAGCTTGATGGGCCCGCCTCACCGGTCCTTCAGGTCCTCG
GTCTCGTCTCGCGCAACACCTCCGTCAGCATCCCCGCCTTCAGCCAGCCCTTCCAGATGCCGCAGGCGAT
CGTGAAGACGGATACCGCACCCACCAACTCCGGCTACACGGAAAAGCTCACCGCCATCGAGCAGGCCCTC
CGCCAGATGATCTCCGCCCCCGGCACCCCGGACCCCAGCGGAGTCAACAGCGCCGCCGGAACGGCGGAAA
CAGCCGTCAACGGCATGCGTGGCAGCTTCGATCCCGCCGGAGTTGTAGACACCAGCGCGGAACGTCTCCT
CCGCGAACCCATTACCTATGTCGGCGGCATCGCCGGCAAGGCTGGCGGCAAGGCAGCCAACAAGGAAGGC
GGAGACTTCTGCGCCGCCGCCAAGACCGTCCTGGACAAGTTCCCCTTCAACCCCGACGCCAAGCTCGACG
CCACCCCGGAAGAGGTCGCAACCTTCTTCAGCCCCACCGGACCCATCGGCGTCTTCGTCGCCAGTCAGTC
CAAGTTCATCGCCTATAACGGCACCCTCTACAGCGCCGTCCCCGGCACGCAGGTCAACCCGGCCCTGCTC
AACTTCCTCAACGCCACCAAGTCGGTCGCCGCCATTCTGCTCCCCAACGGCGCCACCACCCCGAGCCTCA
ACTTCTCCATCACCCAGGAAGCTACCCCCAGCCTCACTGCGGCCACGCTGGATGTGGACGGCACCTCCTA
CTCCACCGTCGGCACCTCCAGCCACATCACCTGGCAGTATCGTGTGCAGGGCTCGGTCAAGCTCGCCGGC
TCCGGCCAGACCAAGAACAGCTTCGGCCCCTGGTCCATCTTCCACTTCGCCTACGCCGCCAAGCACCCCG
CGCCCAACAAGCTCGAATACATCTTCCAGAACAACGGCATCACAGAAAAATCCCAGACCGGCGTCGACAT
CATCTATAACTTCGATCTCGACGAAAACGGCGCAAAACTCCTCAACCCCGACTACATGCGCCACTCCATG
CACTGTGTCTCCACCGTCACCAAATAG
 Primer design