SecReT6
Protein ID: 32265751
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0252
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]243237..246791 [+]
Producthypothetical protein
NoteTssM
UniProt IDQ7VJJ1
KEGG IDhhe:HH0252
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.70E-42, Aligned region: 214..455
DUF1215 [PF06744], Evalue: 6.60E-28, Aligned region: 920..1043
IcmF-related [PF06761], Evalue: 7.00E-28, Aligned region: 550..811
DUF258 [PF03193], Evalue: 0.00027, Aligned region: 98..182
MMR_HSR1 [PF01926], Evalue: 0.0016, Aligned region: 72..109
MMR_HSR1 [PF01926], Evalue: 0.0016, Aligned region: 127..283
MMR_HSR1 [PF01926], Evalue: 0.0016, Aligned region: 842..876
Miro [PF08477], Evalue: 0.0063, Aligned region: 127..167
Miro [PF08477], Evalue: 0.0063, Aligned region: 654..674
Protein Sequence: 1184 a.a.     [Download]
>gi|32265751|ref|NP_859783.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MFGKIFNYLKSKTFLYILLICFALLLSVLFYIYSPLFAFNDIYIFSSALTRIQVLIVVWLLIFFIFLYRP
LIHLIQSLKNEKHIQYKEIKQEVTKAFRRAKRNYFIALNDAKSMWKRKLYLKNIPLVIIIGNEGAGKSSF
INYANIQYPLSESLTSYKKFHKSTNNFNLYISQKGALLDTEGNYFAQENFRQTSNTDEIAEDNLEKNKDF
LIKKGVWNQFLHFLNTNTFHSKLNGIVLIIDVHAFLQNPKQYEQNVLQYLSKRVSDCEENLGLQLPIYIV
FNKIDLLEGMRTYWDIFDESIANKMLGLTLDKNSSKLELQNTFTELSNSLLYTFMRRNQSLHSLEDKNLA
LLFLKQLDVLFALAIDFILQAKEQNAFKNKSYIRGVYFTSAYQENVPRNYLLDAVCEKYEIKKPPAKSAT
KQNKRSYFVQGLLEHIFLKDAHLSSMIKTSWQTFKLAFGTISICIFGYVFCTYLIHKTYKEVDKSHITFN
SITSLLANTSSYEHLTLQEKTELMLHLKAILKNYPSLFEKPSIIQYFSLNFSYQGFLPARDFYYAINEEV
IGKTLLREMEQILLHNTDQTTLIETIYMYQSLYDEAYINKPLLANWVIKNWQPFAKYKIPKDDFITAIED
LAIGNLSHTQPKDTQALHIAKTQIMQLEQQQRIYTIMAFRNSLKKQSFFNLKDKVGTAFYMIFEHTDKLS
QIDKTYTKDGLMEFLSNLDTNIQTAIKIESWAYNEKMQYQALTEQAQRDLYTHIISIYLNDYKQRWEELL
QAISPKQYTDKNNILTQLQILSESTNPLNSLIKIVNDNTHLNDTLLLNYAYGLGLPSSDIKAQFTYISNS
FKDYYDFIGEKSLLLSQIDSFNDIKKQSSTEEIKEILAKDIQNMSGKITEFTKDDTKNIKDKLIYILEGS
NDETDAFVELKRNTAMLPHALKQYYNEISTLSWNVIEKSTYALLNNAWKKEVYDTFINDISPFYPFNAYS
DKSLPLNTFKDFFGNTGTLQSFYTQYLSKILQKKGNTYVPNPAYSETIKLSAQFISFFNQISNLNSIFDN
NNNLTLNFFIQCLGLSSDFSSLDISYNNQTLHYDHTLNPKIQIIIEQFNSSTELRLSVNDYYQMPQYNKI
YSGEWAWLRFIKDITPAQNTGNTLYFENNKQWYFDFSITPNRLELLHLSRILTHFNMPQLITQQ
 
Nucleotide Sequence: 3555 bp     [Download]
>gi|32265499|ref|NC_004917.1|:243237-246791 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGTTTGGCAAGATATTTAATTATCTCAAATCAAAAACTTTTCTCTATATTTTACTTATATGTTTTGCGT
TGCTTTTAAGTGTACTTTTTTACATATACTCGCCCTTATTTGCATTTAATGATATTTATATTTTTAGTAG
CGCATTAACAAGAATCCAAGTGCTTATTGTCGTATGGCTTTTAATCTTTTTTATCTTTCTTTATAGACCA
CTTATTCATCTTATTCAATCGCTCAAAAATGAGAAACACATACAGTACAAGGAAATCAAACAAGAAGTTA
CAAAGGCATTCCGCAGGGCTAAAAGAAATTATTTCATTGCTCTAAATGACGCAAAGAGTATGTGGAAAAG
AAAACTCTATCTTAAAAATATCCCTTTAGTGATTATTATTGGTAATGAGGGAGCAGGCAAAAGCTCGTTT
ATCAATTATGCGAATATACAATATCCATTGAGTGAAAGCTTGACATCTTATAAGAAATTTCACAAATCTA
CCAACAACTTCAATCTTTACATTTCTCAAAAGGGTGCATTGCTTGATACAGAAGGTAATTATTTTGCACA
AGAGAACTTTCGGCAAACAAGTAATACCGATGAAATTGCTGAAGATAATTTAGAAAAGAATAAAGATTTT
TTAATCAAAAAGGGCGTATGGAATCAATTCTTACACTTCCTTAATACTAATACCTTTCATAGCAAACTTA
ATGGCATTGTGCTTATTATTGATGTGCATGCTTTTTTACAGAATCCAAAGCAATATGAACAAAATGTCTT
ACAATATCTAAGCAAAAGAGTGAGTGATTGCGAAGAAAATCTAGGCTTGCAACTCCCCATTTATATTGTT
TTTAATAAAATTGACTTGTTAGAGGGTATGCGGACATATTGGGACATCTTTGATGAAAGCATTGCAAATA
AAATGCTAGGACTTACTTTAGATAAAAATAGTAGCAAATTAGAACTACAAAATACTTTTACAGAATTAAG
CAATTCATTGCTCTATACTTTTATGCGTAGAAATCAATCCTTACATTCACTTGAAGACAAAAATTTAGCC
CTTTTATTTTTAAAGCAACTTGATGTGCTTTTTGCCCTTGCAATAGACTTTATCCTCCAAGCAAAGGAAC
AAAATGCCTTTAAAAACAAATCCTATATCCGCGGCGTATATTTTACCTCCGCATACCAAGAAAATGTCCC
CAGAAATTACTTGCTTGATGCTGTGTGTGAAAAATACGAAATCAAAAAACCTCCGGCAAAATCCGCAACC
AAGCAAAATAAGCGAAGCTACTTTGTGCAGGGTTTGTTAGAACATATTTTTCTTAAAGATGCACATCTAA
GCAGTATGATTAAAACCTCTTGGCAAACTTTCAAACTCGCCTTTGGAACTATAAGTATATGTATATTTGG
ATATGTTTTTTGCACTTATTTAATCCATAAAACCTATAAAGAAGTAGATAAAAGCCATATCACATTTAAT
AGCATTACTTCATTACTTGCCAATACAAGCTCTTATGAACATCTTACCCTGCAAGAAAAAACCGAACTTA
TGCTTCATCTTAAAGCCATACTCAAAAACTATCCATCTCTATTTGAAAAGCCCTCCATTATACAGTATTT
TTCACTGAATTTCTCCTATCAAGGATTTTTGCCTGCAAGAGACTTTTATTATGCTATCAATGAAGAAGTG
ATTGGCAAAACATTGCTTAGAGAAATGGAGCAGATTCTCTTACACAATACCGATCAAACCACACTTATTG
AAACCATCTATATGTATCAATCACTCTATGATGAAGCATATATAAATAAACCTCTTTTGGCAAATTGGGT
TATAAAGAATTGGCAACCTTTTGCTAAATATAAAATTCCAAAAGATGATTTTATTACCGCTATTGAAGAT
TTAGCTATAGGCAATCTCTCACATACACAACCAAAAGATACACAAGCGCTACACATAGCAAAAACTCAAA
TTATGCAATTAGAGCAACAACAGAGAATCTATACCATTATGGCTTTTAGAAATAGCCTAAAAAAACAAAG
CTTTTTTAACCTTAAAGATAAGGTAGGCACAGCATTTTATATGATATTTGAGCATACTGATAAATTAAGT
CAAATTGACAAAACCTATACAAAAGATGGTCTAATGGAGTTTTTAAGTAATTTAGATACCAATATACAAA
CTGCTATCAAAATAGAATCTTGGGCGTATAATGAAAAAATGCAATACCAAGCCCTCACAGAACAAGCACA
AAGAGATTTATACACACATATTATTAGTATTTACCTTAATGATTATAAACAAAGATGGGAAGAATTACTT
CAGGCTATATCTCCTAAGCAATATACCGACAAAAACAATATACTCACACAATTACAAATCTTATCAGAAT
CTACCAATCCACTCAATAGTCTCATTAAAATCGTAAATGATAATACCCACCTAAACGACACTCTTTTGCT
TAATTACGCATACGGCTTAGGATTGCCAAGCTCAGATATTAAAGCACAATTTACATATATTAGTAACTCC
TTTAAAGATTATTATGACTTCATAGGAGAAAAATCCTTACTTCTCTCTCAAATAGATTCCTTTAATGACA
TAAAAAAGCAAAGTAGCACGGAAGAAATAAAAGAGATACTCGCTAAAGATATACAAAATATGAGTGGTAA
AATTACAGAATTTACAAAAGATGATACAAAAAACATAAAAGATAAGCTTATATATATCCTTGAAGGAAGT
AATGATGAAACTGACGCATTTGTAGAGCTAAAGCGAAACACAGCAATGTTGCCTCATGCGTTAAAACAAT
ACTACAATGAGATTTCTACACTCTCTTGGAACGTTATAGAAAAAAGCACCTATGCACTTCTAAATAATGC
ATGGAAAAAAGAGGTGTATGATACTTTTATAAATGATATCTCCCCTTTTTATCCTTTCAATGCTTACTCG
GATAAATCCTTGCCACTCAACACTTTTAAAGATTTTTTTGGCAATACAGGCACATTACAATCTTTTTATA
CGCAATATCTAAGTAAAATTTTGCAAAAAAAAGGCAATACCTATGTGCCAAATCCTGCCTATAGCGAGAC
GATAAAGCTTTCTGCTCAATTTATAAGTTTTTTTAACCAAATAAGCAATCTCAATAGCATATTTGATAAT
AACAATAACCTTACACTTAACTTTTTTATACAATGCCTTGGTTTATCATCAGATTTTAGCTCTCTTGATA
TAAGCTATAACAACCAGACTTTACACTATGATCACACGCTTAATCCTAAAATCCAGATTATTATTGAACA
ATTCAATAGTAGCACGGAGTTACGTTTGAGCGTGAATGACTATTACCAAATGCCTCAATACAATAAAATT
TATAGTGGCGAATGGGCGTGGCTTAGATTCATAAAAGACATTACACCTGCTCAAAATACAGGCAACACTC
TTTACTTTGAAAATAATAAACAATGGTATTTTGATTTTAGCATTACTCCAAATAGGCTAGAACTTTTACA
TTTAAGCCGTATTCTAACGCATTTTAATATGCCTCAACTTATCACTCAACAATAA
 Primer design