SecReT6
Protein ID: 322835260
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4578
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]143273..146689 [+]
ProductImcF domain protein
NoteTssM
UniProt IDE8Y0Z3
KEGG IDrah:Rahaq_4578
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.90E-70, Aligned region: 412..725
DUF1215 [PF06744], Evalue: 2.00E-34, Aligned region: 260..296
DUF1215 [PF06744], Evalue: 2.00E-34, Aligned region: 844..964
Protein Sequence: 1138 a.a.     [Download]
>gi|322835260|ref|YP_004215286.1| ImcF domain protein [Rahnella sp. Y9602]
MTIRSLIGSAFLFLIFIVIVVGGTLTFYPQWVASTFGIGPLSPSGIWTLCLSIAAGLGAVFWLIERMFDR
IGKAGVRIQWRKRKNQQTGAPAVSDTVSPSPSFFTGLDEQMRFRYGRFWRRKVQILWLTGETELVEKIAP
GLTEQNWQEGDDTLLLWGGLPDVPVDPERAIAARLLRPRRPLDGIVHVLEGNQLPGTTSLDETLRQRQKT
DALLGWQAPVYFWVLDRCKWSQEGRETQPVGCLLSGKTSAESVLTALDALIPALREQGMSQLAQDTRYDF
LLRLTERLRKEWRAGLSNVLTTVSRGSSPMMLRGLMFSLPSSAEKGSSHSWEALPEWQGILQDCRNAQGK
RTGWPWEKILQCTLLTLAVVWGAGVLLSLFINQHQIADSHEQAIIAADTTQPLASRLNNQLALQQEIAKL
QYRETAGSPWYTRFGLNQNASQLAALWPLYQANNNVLIRDASATKLKAKLTDFIRLPPGSPQRDALTQQT
YAELKAYLMMSRPDKADATFLSQTLMTLWPKRTGVPDGQWQHVGPKLIAFWGQNLPAHPEWKIAQDKNLV
TAVRQILLKQIGQRNAEASLYQAMLKKVANNYPDMTLTDMVGDTDASYLFNTDEVVPGMFTRQAWEEQVQ
DAIDQVVTTRRNEIDWVLTSKSQPASEDISPEALKARLTERYFTDFSNAWLNMVNSLRWQEPGSLSGAIS
QLTLMADVRQSPMVALMNTLAWQGKTGQKNEALADTLVNSAKVLVGKKQQPVIKQTGGPQGPLDAAFGPL
LTIMDGKSNGVNNGNLSFQAYLTRVTQVRLKLQQVTTAPDPQAMTQMLAQTVFQGKAVDLTDTRDYGSLV
AASLGQEWSGFGKAMFVEPMELAWRQVLQPAAGSLNAQWQSNVVNQWDTSFAGRYPFASTGSDASLPVVA
QYLRSDSGRISQFLKTQLGGILHQEGNRWVPDAITSQGLTFNPAFLDAINQLGQLSDIVFAEGDAGLRFE
LMARPSKNVVRTELAVDGQNLDYFNQMESWQSFKWPGNSYYPGVQLSWRSVSSGMQLFGDFSGNWGLIRL
LEKAQVTQLDSSRYQLVWKTRDGLPLKYILRTEMGNGPLALLALRNFSLPKKVFLDDAPVSSVVAADPGP
VLTDDQDIPAGTGSAGDE
 
Nucleotide Sequence: 3417 bp     [Download]
>gi|322835126|ref|NC_015062.1|:143273-146689 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
GTGACAATCAGATCCCTAATAGGCAGCGCCTTTCTGTTTTTGATTTTTATCGTCATCGTTGTGGGAGGCA
CCCTCACCTTCTATCCACAATGGGTAGCTTCCACCTTTGGCATCGGCCCGTTATCACCTTCCGGTATCTG
GACACTTTGTCTGAGTATTGCCGCCGGGCTGGGGGCGGTTTTCTGGCTGATCGAGCGTATGTTCGATCGC
ATCGGGAAGGCTGGCGTTCGTATCCAGTGGCGTAAACGGAAAAATCAGCAGACAGGGGCACCCGCGGTCT
CAGATACCGTGAGTCCGTCCCCTTCGTTTTTCACCGGTCTGGACGAGCAGATGCGTTTTCGCTATGGCCG
GTTTTGGCGCAGGAAAGTGCAGATCCTCTGGCTGACCGGAGAAACTGAGCTGGTTGAAAAGATAGCGCCA
GGACTGACAGAACAAAACTGGCAGGAAGGTGACGACACCTTGCTTTTGTGGGGCGGCTTACCGGATGTGC
CCGTTGATCCTGAACGTGCGATAGCCGCAAGACTATTGCGTCCGCGCCGTCCGTTAGACGGAATTGTTCA
TGTACTGGAGGGTAATCAGTTACCAGGCACCACCTCACTGGATGAAACCCTGCGCCAGCGCCAAAAAACC
GATGCGCTGCTTGGCTGGCAGGCACCGGTGTATTTTTGGGTGCTCGACAGATGTAAATGGTCACAGGAAG
GCAGGGAAACACAACCCGTAGGGTGTTTGTTATCAGGAAAAACTTCCGCAGAATCTGTGCTTACCGCACT
GGATGCGCTCATCCCTGCGCTACGTGAGCAAGGCATGTCCCAGCTTGCCCAGGACACCCGATATGACTTT
TTATTGCGTCTTACTGAAAGATTGCGCAAAGAATGGCGTGCGGGCCTGAGTAATGTGCTGACCACGGTTT
CCCGGGGTTCCTCTCCGATGATGTTGCGCGGGCTGATGTTCAGTCTGCCATCCAGCGCAGAGAAGGGGTC
TTCACATAGCTGGGAGGCTCTGCCTGAGTGGCAGGGCATTCTTCAGGATTGCCGGAATGCGCAAGGGAAA
CGAACAGGATGGCCTTGGGAAAAAATATTGCAATGCACCCTTCTGACCCTGGCTGTAGTTTGGGGAGCGG
GTGTTTTGCTTTCGCTTTTTATCAATCAGCATCAGATTGCTGACTCTCATGAACAGGCCATTATTGCAGC
CGATACGACTCAGCCCTTGGCCTCACGCCTGAATAATCAGCTAGCACTTCAACAGGAAATTGCGAAATTA
CAGTACCGGGAAACCGCCGGTTCTCCCTGGTATACCCGCTTTGGCCTGAATCAGAATGCCTCACAGCTGG
CGGCACTTTGGCCGTTGTATCAGGCCAACAATAATGTGTTAATCCGGGATGCTTCTGCCACGAAACTTAA
GGCAAAATTAACAGACTTTATCCGGTTGCCACCGGGCAGCCCGCAGCGTGATGCCCTGACACAGCAAACC
TATGCTGAGCTTAAAGCCTACCTGATGATGTCGCGTCCGGATAAAGCCGATGCAACGTTTTTAAGCCAGA
CACTGATGACCCTCTGGCCAAAACGCACCGGGGTTCCGGACGGGCAATGGCAACATGTCGGACCCAAACT
GATCGCCTTCTGGGGGCAGAACCTGCCCGCGCATCCGGAATGGAAAATAGCGCAGGATAAAAACCTCGTC
ACCGCTGTCCGGCAGATCCTGCTAAAGCAAATTGGCCAGCGCAATGCGGAAGCATCGCTGTATCAGGCCA
TGCTAAAGAAAGTGGCAAATAACTATCCGGATATGACCCTGACAGACATGGTGGGTGATACCGACGCTTC
TTATCTGTTCAACACAGACGAGGTCGTGCCGGGAATGTTCACCCGTCAGGCGTGGGAAGAGCAGGTTCAG
GATGCTATCGATCAGGTGGTTACTACCCGACGCAATGAAATTGACTGGGTTCTGACCAGTAAATCCCAAC
CCGCTTCTGAAGACATCTCCCCGGAGGCGCTAAAGGCACGACTCACCGAACGTTATTTCACTGATTTTAG
CAATGCCTGGCTGAACATGGTTAACAGTCTGCGCTGGCAGGAGCCCGGATCTCTTTCGGGGGCAATTTCC
CAGCTCACGCTGATGGCAGATGTACGCCAGTCTCCGATGGTGGCATTGATGAATACGCTGGCCTGGCAGG
GAAAAACGGGGCAGAAAAACGAAGCTCTGGCCGATACGCTGGTGAATTCAGCGAAAGTTCTGGTGGGTAA
AAAACAGCAACCTGTTATTAAACAAACAGGCGGCCCCCAAGGTCCGCTCGACGCCGCCTTCGGCCCCTTG
TTGACCATCATGGATGGCAAAAGTAATGGTGTAAATAATGGCAATCTCAGCTTCCAGGCCTATTTAACCC
GTGTAACACAGGTTCGCCTGAAGCTTCAGCAGGTCACTACCGCACCGGATCCGCAGGCGATGACCCAGAT
GCTGGCTCAAACTGTCTTTCAGGGTAAAGCCGTCGATTTAACCGACACCCGTGATTACGGCAGTCTGGTT
GCAGCCAGTCTGGGTCAGGAATGGAGCGGCTTCGGGAAAGCGATGTTTGTAGAGCCTATGGAGCTTGCCT
GGCGTCAGGTATTGCAACCCGCAGCCGGCAGTCTGAATGCGCAATGGCAAAGTAACGTGGTCAACCAGTG
GGATACTTCATTTGCCGGACGGTATCCGTTCGCCAGCACCGGCAGCGATGCATCCTTACCTGTCGTCGCG
CAATATCTCCGTTCCGACTCCGGACGTATCTCGCAATTCCTGAAAACTCAACTCGGTGGCATTTTACACC
AGGAAGGTAACCGCTGGGTGCCGGATGCCATTACCAGTCAGGGACTGACCTTTAATCCGGCATTCCTTGA
TGCCATCAACCAGTTGGGCCAGTTATCTGACATCGTATTTGCTGAGGGTGATGCAGGATTACGTTTTGAA
TTAATGGCCCGCCCGTCAAAAAATGTCGTCCGCACGGAACTCGCTGTCGACGGGCAAAATCTGGACTATT
TCAACCAGATGGAAAGCTGGCAGAGCTTTAAATGGCCGGGAAATTCCTACTATCCCGGCGTACAGCTCAG
CTGGCGCAGTGTCAGTTCCGGTATGCAACTGTTTGGCGACTTTTCAGGGAACTGGGGATTAATACGCCTT
CTGGAAAAAGCCCAGGTTACCCAACTCGACAGCAGCCGTTACCAGCTGGTCTGGAAAACCCGTGATGGTC
TGCCATTGAAATACATACTGAGAACAGAAATGGGCAATGGACCGCTGGCATTGCTGGCTTTACGTAACTT
CTCTTTGCCCAAAAAAGTATTTTTAGATGATGCGCCTGTCTCTTCTGTCGTTGCCGCCGATCCCGGACCC
GTACTGACAGACGATCAGGATATCCCCGCAGGAACGGGCTCTGCCGGAGATGAGTAA
 Primer design