SecReT6
Protein ID: 322835478
SecReT6 ID423
T6SS typeN/A
Gene symbol-
Locus tagRahaq_4798
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]367893..368978 [-]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDE8XZW6
KEGG IDrah:Rahaq_4798
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-76, Aligned region: 40..336
Protein Sequence: 361 a.a.     [Download]
>gi|322835478|ref|YP_004215504.1| type VI secretion protein, VC_A0111 family [Rahnella sp. Y9602]
MAGTPPDAGVVLMMPDDFDDDVKKKENVLKEFWRDKDGNDRAHAFNFYRFCQLLEKQLSDNKPLGSTFSP
KNDAVRFRPHPGMGFPVSELKAVETSEERPDAPPTVRTTFMGLYGVDSPLPTGYIDDITQRREGHEALEA
FLDIFNHRMMTQFYRIWRKYNYPATFEEGGTDKTSRSLMALTGITDSGDVPASRLLALLQPLVRTTRTAE
GITSVIRSQAPNTQVTVKPHKVTRIPAGKRARFSFSAQQRLGDHLVLGSETSDANYCIGVEMFTEDPTEA
NGWLPGGQLREDVFTLLRVYLGCDYDASLTLTIPMKLAPLPRLGDRTLFAGYNVVLGLREDNLDKMPEQV
TMKLGRIRDKR
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|322835126|ref|NC_015062.1|:c368978-367893 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGCCGGAACGCCGCCTGACGCGGGTGTTGTTCTGATGATGCCAGATGATTTTGATGACGATGTAAAAA
AGAAAGAGAACGTCCTGAAGGAATTCTGGCGGGACAAGGACGGTAACGACCGGGCGCACGCCTTTAACTT
CTACCGTTTCTGCCAGCTGCTGGAAAAACAGCTCTCGGATAATAAACCTCTCGGCAGCACCTTCTCGCCG
AAAAATGACGCGGTGCGTTTTCGTCCGCATCCGGGGATGGGTTTTCCGGTCAGCGAGCTTAAAGCCGTCG
AAACGAGCGAAGAACGCCCGGACGCGCCGCCGACGGTGCGCACCACCTTTATGGGGCTGTACGGCGTGGA
TTCGCCGCTGCCGACCGGCTACATCGATGACATCACCCAGCGGCGCGAAGGTCACGAGGCGCTGGAAGCC
TTTTTAGACATCTTCAACCACCGGATGATGACGCAGTTTTACCGCATCTGGCGAAAGTACAATTATCCCG
CCACCTTTGAGGAAGGCGGGACCGACAAAACGTCGCGCAGCCTGATGGCCCTGACCGGCATCACCGACAG
CGGCGACGTGCCCGCCTCGCGATTGCTGGCGTTATTGCAGCCGCTGGTCAGAACTACCCGCACGGCGGAA
GGTATCACCAGCGTGATCCGCTCGCAGGCACCCAACACGCAGGTCACCGTAAAACCGCATAAGGTCACGC
GGATACCCGCCGGCAAACGTGCTAGATTCTCTTTCTCAGCTCAGCAACGCCTGGGCGACCATCTGGTTCT
CGGCAGTGAAACCTCGGATGCCAACTACTGCATTGGCGTGGAGATGTTTACCGAAGACCCAACTGAGGCC
AACGGCTGGCTGCCCGGCGGTCAGTTGCGGGAAGACGTCTTTACCCTGCTGCGCGTCTATCTGGGGTGTG
ACTACGACGCCAGCCTGACGCTGACCATTCCGATGAAGCTCGCACCGCTGCCGCGTCTGGGCGATCGCAC
TCTGTTCGCGGGTTACAACGTGGTGCTGGGATTGCGGGAAGATAATCTGGATAAAATGCCGGAACAGGTG
ACGATGAAACTGGGCAGAATCAGGGATAAGAGGTAA
 Primer design