SecReT6
Protein ID: 322835479
SecReT6 ID423
T6SS typeN/A
Gene symbol-
Locus tagRahaq_4799
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]368942..370717 [-]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDE8XZW7
KEGG IDrah:Rahaq_4799
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-120, Aligned region: 5..588
Protein Sequence: 591 a.a.     [Download]
>gi|322835479|ref|YP_004215505.1| type VI secretion protein, VC_A0110 family [Rahnella sp. Y9602]
MEDDFLKYFDGEMRYLKEAGLEFAKEFPELGRALGLDGSPVPRDDSVERLFQGFSLMMAKLRQKIDDDIP
ELTEPLLSHLLPVINRTLPSTAVVELTPVAPELHVREEVLPAESDLLTQPLGNDRQRCVYRTTRDLKVHP
FALDNVSLFTLQEGQQALKLRFTLPALTEIRRADWQNISLYLNGDRVLQSALYLALSRQVKRVNVRFWQK
STELMPVDVQFVPRWQAENDASIWPESDSPALCGEVRPWLEYFTSPARYFFMQLRGLETLTFPPDTTSFD
IEVTLSERWPYDLAVPPDAIRMHCVPVINLFRLLAQPLSVTTAVSDYRLRPHRLSDGHTEIYAVNDVAEV
TEDNAEFSYVPYSQFRQKGGMLQYKKNWPDRYYHTRMYRGPSGLNETILMLGGRTHEAQNGLKMRLNMTC
TNGAWPRMALQESVFDGETAPGNLELKCATRTRPTMPHYPPTAELYQWQVLSLLHPQAIAGLMETDTLRH
ALSLLDWTHDPDNARRVAGITHVEYTPSHYPAEGWHGVAIRVTLDEHHFCGQGDALLFCEVLEQFYTQYA
DIRRFTQLTVTLSQSGTQWAWPERRLTRVLF
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|322835126|ref|NC_015062.1|:c370717-368942 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGAAGACGATTTCTTAAAATATTTTGACGGCGAAATGCGCTACCTGAAGGAAGCCGGGCTGGAGTTTG
CGAAAGAGTTCCCGGAGCTGGGACGCGCGTTAGGTCTGGACGGCAGTCCGGTACCGCGCGATGACTCCGT
CGAACGGCTGTTTCAGGGCTTTTCGCTGATGATGGCCAAGCTGCGTCAGAAGATAGATGACGATATTCCC
GAGCTGACTGAGCCTCTGCTCTCGCACCTGCTGCCGGTGATCAACCGCACGCTGCCCTCCACGGCAGTGG
TCGAACTGACACCGGTCGCGCCGGAGCTGCATGTGCGCGAAGAGGTGTTGCCCGCTGAAAGCGATCTGTT
AACCCAGCCACTGGGCAACGACCGTCAGCGCTGCGTTTATCGCACCACCCGCGACCTGAAAGTCCATCCG
TTTGCGCTTGATAACGTCTCGTTATTCACCCTGCAGGAAGGCCAGCAGGCGCTGAAACTGCGCTTCACCC
TGCCCGCCCTCACTGAAATCCGCCGCGCCGACTGGCAAAACATCAGCCTGTATCTCAACGGCGACCGCGT
GCTGCAGTCAGCGCTGTATCTGGCCCTCAGCCGTCAGGTGAAGCGGGTGAACGTGCGGTTCTGGCAGAAA
TCGACAGAGCTGATGCCAGTAGACGTGCAGTTTGTGCCACGCTGGCAGGCAGAAAACGACGCCTCAATCT
GGCCGGAGAGCGACAGTCCGGCCCTGTGCGGCGAGGTGCGCCCGTGGCTGGAATATTTCACTTCACCGGC
GCGTTATTTCTTTATGCAGCTGCGCGGGCTGGAAACCCTGACCTTTCCGCCTGACACCACCTCGTTTGAT
ATCGAGGTGACGCTCAGCGAACGCTGGCCGTACGATCTGGCCGTGCCGCCGGACGCCATCCGCATGCACT
GCGTGCCGGTGATTAACCTGTTCCGCCTGCTGGCCCAGCCGCTCTCCGTGACCACCGCGGTCAGTGATTA
CCGCCTGCGACCACACCGGCTCAGCGACGGCCACACCGAAATCTATGCGGTCAATGACGTCGCGGAAGTG
ACTGAGGACAACGCCGAATTCAGCTACGTACCCTACAGCCAGTTTCGCCAGAAAGGCGGCATGCTCCAGT
ATAAGAAAAACTGGCCCGACCGTTATTACCACACCCGCATGTACCGGGGTCCTTCCGGACTGAACGAGAC
CATTTTAATGCTCGGTGGACGCACCCACGAGGCGCAGAACGGCCTGAAAATGCGCCTGAACATGACCTGT
ACCAACGGCGCCTGGCCGCGCATGGCGTTGCAGGAGAGCGTATTCGACGGCGAGACCGCCCCGGGTAATC
TTGAGCTGAAGTGTGCCACCCGCACGCGTCCCACTATGCCGCATTACCCGCCGACCGCTGAACTTTATCA
GTGGCAGGTGCTGTCGCTGCTGCATCCGCAGGCCATCGCCGGTCTGATGGAAACCGACACGCTGCGTCAC
GCGCTCAGCCTGCTGGACTGGACGCATGACCCGGACAACGCGCGCCGCGTTGCGGGCATTACGCACGTTG
AATACACACCGTCGCACTACCCCGCTGAAGGCTGGCACGGCGTGGCCATCCGCGTAACCTTGGATGAGCA
TCATTTCTGTGGCCAGGGCGATGCATTGCTGTTTTGCGAGGTTCTGGAGCAGTTCTACACCCAGTACGCC
GATATCCGCCGGTTCACACAGCTGACAGTCACGCTCAGTCAGTCCGGGACACAATGGGCATGGCCGGAAC
GCCGCCTGACGCGGGTGTTGTTCTGA
 Primer design