SecReT6
Protein ID: 322835480
SecReT6 ID423
T6SS typeN/A
Gene symbol-
Locus tagRahaq_4800
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]370717..371250 [-]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDE8XZW8
KEGG IDrah:Rahaq_4800
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-37, Aligned region: 20..170
Protein Sequence: 177 a.a.     [Download]
>gi|322835480|ref|YP_004215506.1| type VI secretion lipoprotein, VC_A0113 family [Rahnella sp. Y9602]
MTPDNFQRVRRGTVLLLLPLLISSCGLTQRVGSGASAVAEAVLYRKIDTLHLKLTSRAALNSNEGGEALP
TVVRVYQLKDRKTFDTASYAALLRQDNTVLAADLLDRQVVQVMPDAEATVAVPLHADAKFVAVVALFMAP
DATNNTWRLVLERNDLDDSKDRIVELNDNRLQLRKNQ
 
Nucleotide Sequence: 534 bp     [Download]
>gi|322835126|ref|NC_015062.1|:c371250-370717 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGACGCCCGATAATTTCCAGCGAGTAAGACGCGGCACCGTGCTGTTATTACTGCCCTTACTGATAAGCA
GCTGCGGCCTGACGCAGCGCGTGGGAAGCGGCGCCTCTGCGGTCGCAGAGGCCGTGCTCTACCGTAAAAT
AGACACCCTGCATCTGAAGCTGACCTCCCGCGCCGCGCTCAACAGCAACGAAGGCGGCGAGGCGCTGCCG
ACGGTGGTTCGCGTTTATCAGCTCAAAGACCGTAAAACCTTTGATACGGCCAGCTACGCCGCCCTGCTCA
GGCAGGACAACACCGTGCTGGCCGCTGACCTGCTCGACCGGCAGGTTGTCCAGGTGATGCCGGACGCAGA
GGCGACGGTGGCCGTGCCGCTGCATGCCGACGCAAAGTTTGTCGCCGTGGTGGCCCTCTTTATGGCACCG
GATGCCACAAACAACACCTGGCGGCTGGTTCTCGAACGTAATGACCTCGATGACAGTAAAGACCGGATCG
TTGAGCTCAATGACAACCGGCTGCAGCTCAGGAAAAATCAGTAA
 Primer design