SecReT6
Protein ID: 322835481
SecReT6 ID423
T6SS typeN/A
Gene symbol-
Locus tagRahaq_4801
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]371237..374605 [-]
ProductImcF domain protein
NoteTssM
UniProt IDE8XZW9
KEGG IDrah:Rahaq_4801
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.10E-65, Aligned region: 410..707
DUF1215 [PF06744], Evalue: 2.10E-32, Aligned region: 835..956
Protein Sequence: 1122 a.a.     [Download]
>gi|322835481|ref|YP_004215507.1| ImcF domain protein [Rahnella sp. Y9602]
MTKSLHLMLVVMLALALSLLWLNADGETLTHGVAWWATGVILLSYFLLARYAFALELLDFNRPPEAQDDA
RITAFDTLRFTLRHRYGWHWKHKQPWLLVTGEAAVVEKVAPGLTQARWQESQNAVLIWCGEADALDLAAV
TQLRDMRGRRAFNAVLWVTDVTAAPEYLWTTQPVPNQTLPAGNSDTVYRQFIALGHTLSWRPPVFGVCLS
EPQWEQDDRPVQSIGCHWPAGTPVSLDDQLSQLAATLIPQGVAQLSENKHWAWLLQLSGDLKHHTGALLR
QRFQPWLGEHQRVLAGGIFFMPAAPEPASVQQRSHACYLSPAWNGVIAQSRTQQGRRDHLSTGDKLAIGT
LTLAGLWVLGMGISACANRTLIADSQALLQAARTPAPMSDTLTRSVALQDNIDRLLWWQQNGSPWLHRFG
LDQRDAVIEALWPAYTRQSQALLLTPMVNALKDRLQAFVSLPPGSAERRLAGKLAYQQLKAYLMLLHPEH
ADPAFMQPVLSPLWTVPDGVAPGEWLARSDKLLGFYLQQLPRHLQWKLPADDQLVANVRTILRSQKGISN
SENALYQQVLLSVSPHYADVTLDSLLGETAGGQLFSTDDNLPGMFTREAWEGEVSDAIDKAAAARHVTSD
WVLDDKGEQQLLTKDQLQYRLTERYFADYTSAWLNFLNSIRWNTSDSLSTSLDQLTQLADARQSPLLALS
RTLRYQGAAGQHREAMGDSLLKSAQKLVSKTTPPAGFAGGRNDPTRVLSETFAPLLAVLPPETPAAGETP
AAQNTASVSVSNYLLQVSQTRLQLMQVANASDPQAMAQSLVKSAFSNSDTTLSQGRHYAQLLAASLGGEW
SSFADAAFVQPLEQAWNGVMTPAQQGINSAWQVQVQNPWQAEFTGRYPFDNTKNDADFTQLAHYLTPDTG
LIDQFITRQLAGVLEKQGDSWVPDPLNTQGMSINPDFLSAVNQLSQLGRRVFPQGKPGVTFELQIRPTRN
VVETDLQIDDATLKYFNQLPGWQTFRWPDAASDHPQVSLTYSPVAASGKSADAFQSYFQADGGWAWLRLL
DKAQVEQLDSSRYRLSWQTATKETLNVVLRTQSGGGPLELLTLRRFKLPAQIFTSPDLSTENAEDTTRHD
AR
 
Nucleotide Sequence: 3369 bp     [Download]
>gi|322835126|ref|NC_015062.1|:c374605-371237 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGACTAAAAGCCTTCACCTGATGCTGGTGGTGATGCTCGCCCTGGCCCTGAGCCTTCTGTGGCTGAACG
CCGACGGAGAAACCCTCACCCACGGCGTGGCCTGGTGGGCAACCGGCGTCATCCTGCTGAGCTATTTTCT
GCTGGCCCGCTACGCCTTCGCCCTGGAATTGCTCGATTTTAACCGCCCGCCCGAGGCACAGGACGACGCG
CGCATCACGGCGTTTGACACCCTGCGTTTCACCCTGCGTCACCGCTATGGCTGGCACTGGAAGCACAAAC
AGCCATGGCTTTTGGTCACCGGTGAGGCGGCGGTGGTGGAAAAAGTCGCCCCCGGCCTGACGCAGGCGCG
CTGGCAGGAAAGCCAGAATGCCGTCCTTATCTGGTGTGGCGAGGCTGACGCGCTGGATTTAGCCGCCGTC
ACGCAGCTGCGCGACATGCGCGGGCGCCGCGCCTTTAACGCCGTGCTGTGGGTCACCGATGTGACGGCTG
CGCCGGAATACCTGTGGACTACGCAGCCGGTGCCTAATCAGACCCTGCCGGCCGGCAACAGCGACACCGT
CTATCGGCAGTTTATCGCGCTCGGGCACACCCTCAGCTGGCGTCCGCCGGTGTTTGGCGTGTGCCTGAGT
GAGCCGCAGTGGGAACAGGACGACCGCCCGGTGCAGAGTATCGGCTGCCACTGGCCGGCGGGCACGCCGG
TCTCACTTGATGACCAGCTCAGTCAGCTTGCCGCCACGCTCATCCCGCAGGGCGTTGCGCAGCTGAGCGA
GAACAAACACTGGGCCTGGCTGCTGCAGCTGTCAGGGGATCTGAAACACCACACCGGCGCGTTGCTCAGG
CAGCGTTTTCAGCCGTGGCTCGGTGAGCATCAGCGCGTACTGGCCGGCGGCATCTTCTTTATGCCTGCTG
CCCCTGAACCGGCTTCTGTTCAGCAACGCTCCCACGCCTGCTATTTGTCCCCCGCCTGGAACGGCGTTAT
CGCGCAAAGCCGGACGCAGCAGGGTCGCCGCGACCACCTGTCCACCGGTGACAAACTGGCCATCGGCACG
CTGACGCTGGCGGGGCTGTGGGTACTCGGCATGGGAATATCTGCCTGTGCCAACCGCACGCTTATCGCCG
ACAGCCAGGCACTGCTGCAGGCGGCCCGCACGCCGGCCCCGATGTCCGACACGCTGACCCGCAGCGTAGC
CCTGCAGGACAACATTGACCGCCTGCTGTGGTGGCAGCAAAACGGCTCGCCGTGGCTGCACCGCTTCGGT
CTCGATCAGCGCGACGCGGTGATCGAAGCACTGTGGCCCGCCTATACCCGGCAAAGTCAGGCGCTGCTGT
TAACGCCTATGGTTAACGCGCTGAAAGACCGGCTGCAGGCGTTTGTGTCCCTGCCGCCAGGCTCTGCCGA
ACGACGTCTGGCCGGGAAACTGGCCTATCAGCAGCTGAAAGCCTACCTGATGCTGCTGCATCCTGAACAC
GCCGACCCGGCCTTTATGCAACCGGTGCTGTCTCCTCTGTGGACGGTGCCGGACGGCGTGGCTCCCGGAG
AATGGCTGGCCCGTTCAGACAAACTGCTCGGCTTTTATCTGCAGCAACTGCCGCGCCATCTGCAGTGGAA
GCTGCCCGCCGATGACCAGTTGGTGGCCAACGTGCGTACCATCCTGCGCAGTCAGAAAGGCATCAGCAAC
AGCGAAAACGCGCTGTATCAGCAGGTGTTGCTGAGCGTGTCGCCGCACTATGCCGACGTCACGCTCGACA
GCCTGCTCGGGGAAACCGCCGGCGGTCAGCTGTTCTCCACCGATGACAACCTGCCGGGCATGTTCACCCG
TGAAGCCTGGGAGGGGGAAGTCAGCGACGCGATTGATAAAGCGGCTGCGGCACGCCACGTCACCTCCGAC
TGGGTGCTGGATGATAAAGGCGAACAACAGCTGCTGACCAAAGACCAGCTGCAGTACCGCCTGACCGAAC
GCTACTTTGCCGATTACACCAGCGCCTGGCTCAATTTCCTCAACAGCATCCGCTGGAACACCAGCGACTC
GCTGAGCACCTCCCTCGATCAGCTGACCCAGCTGGCCGATGCCCGCCAGTCGCCGCTGCTGGCCCTGAGC
CGCACCCTACGTTATCAGGGCGCGGCCGGTCAGCACCGCGAAGCGATGGGGGACTCCCTGCTGAAATCGG
CACAAAAGCTGGTGTCGAAAACCACGCCGCCCGCCGGATTCGCCGGCGGGCGCAATGACCCGACCCGCGT
GCTGAGCGAGACCTTCGCCCCGCTGCTGGCCGTGTTACCGCCGGAAACCCCGGCGGCAGGTGAAACGCCT
GCTGCACAGAATACCGCCAGCGTCTCCGTCAGCAACTACCTGCTGCAGGTGTCACAAACGCGATTACAGC
TGATGCAGGTGGCCAATGCCTCCGACCCGCAGGCGATGGCACAAAGCCTGGTCAAATCCGCCTTCAGCAA
CAGCGACACCACGCTGTCGCAGGGCCGTCACTACGCGCAGCTTCTGGCAGCCAGCCTGGGTGGCGAATGG
AGCAGCTTTGCCGACGCTGCGTTTGTCCAGCCGCTGGAACAGGCGTGGAACGGCGTGATGACTCCGGCAC
AGCAGGGGATCAACAGCGCCTGGCAGGTTCAGGTGCAGAACCCGTGGCAGGCGGAATTTACCGGACGCTA
CCCGTTCGATAACACCAAAAATGACGCCGACTTCACCCAACTGGCTCACTACCTGACGCCGGATACCGGC
CTGATTGACCAGTTTATTACCCGGCAACTGGCCGGCGTGCTGGAAAAGCAGGGTGACAGCTGGGTACCTG
ACCCGCTCAACACCCAGGGAATGAGCATCAACCCGGACTTCCTCAGCGCGGTTAACCAGCTGAGCCAACT
CGGCCGCCGCGTCTTCCCGCAGGGTAAACCCGGCGTGACCTTTGAGCTCCAGATCCGCCCGACCCGCAAC
GTAGTCGAAACTGACCTGCAGATAGACGATGCCACCCTGAAGTACTTTAACCAGCTGCCGGGCTGGCAGA
CGTTCCGCTGGCCAGACGCCGCAAGCGATCACCCGCAGGTGTCCCTGACGTACTCACCGGTCGCGGCATC
AGGGAAAAGCGCCGACGCCTTCCAGAGCTATTTTCAGGCGGACGGCGGCTGGGCCTGGCTGCGTTTACTC
GATAAGGCGCAGGTTGAACAGCTCGACAGCAGCCGCTATCGCCTGAGCTGGCAAACCGCCACCAAAGAGA
CGCTAAACGTGGTGTTACGCACCCAAAGCGGCGGCGGCCCGCTGGAACTGCTTACCCTGCGACGCTTTAA
GCTGCCGGCCCAAATATTTACCTCTCCGGACCTGTCCACGGAAAATGCGGAGGACACAACGCGCCATGAC
GCCCGATAA
 Primer design