SecReT6
Protein ID: 322835483
SecReT6 ID423
T6SS typeN/A
Gene symbol-
Locus tagRahaq_4803
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]376010..376264 [-]
Producthypothetical protein
NotePAAR
UniProt IDE8XZX1
KEGG IDrah:Rahaq_4803
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.80E-16, Aligned region: 6..75
Protein Sequence: 84 a.a.     [Download]
>gi|322835483|ref|YP_004215509.1| hypothetical protein Rahaq_4803 [Rahnella sp. Y9602]
MRGVIRLDDPHTHGGKVSSASGAIFEGKPVMLAGDTVSCSQHGTVPVNQGHPTWKMNGKAVIVDGCVAQC
GCTLKTTLPNAGAQ
 
Nucleotide Sequence: 255 bp     [Download]
>gi|322835126|ref|NC_015062.1|:c376264-376010 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGCGCGGAGTCATTCGCTTAGACGATCCCCATACCCACGGCGGCAAAGTCAGCTCAGCGTCAGGTGCCA
TCTTTGAGGGTAAACCGGTTATGTTAGCCGGTGATACCGTCAGCTGCTCTCAGCATGGCACTGTACCGGT
AAATCAGGGGCATCCGACCTGGAAAATGAACGGCAAAGCCGTGATTGTGGACGGTTGTGTTGCGCAGTGT
GGTTGCACTCTCAAAACAACCCTGCCGAACGCCGGAGCGCAATGA
 Primer design