SecReT6
Protein ID: 322835488
SecReT6 ID423
T6SS typeN/A
Gene symbol-
Locus tagRahaq_4808
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]380509..383016 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDE8XZX6
KEGG IDrah:Rahaq_4808
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 3.30E-44, Aligned region: 613..761
Phage_GPD [PF05954], Evalue: 3.10E-39, Aligned region: 44..350
T6SS_Vgr [PF13296], Evalue: 3.60E-33, Aligned region: 491..596
Phage_base_V [PF04717], Evalue: 5.50E-12, Aligned region: 410..484
Sarcoglycan_1 [PF04790], Evalue: 0.0015, Aligned region: 684..722
Sarcoglycan_1 [PF04790], Evalue: 0.0015, Aligned region: 783..807
Protein Sequence: 835 a.a.     [Download]
>gi|322835488|ref|YP_004215514.1| Rhs element Vgr protein [Rahnella sp. Y9602]
MSIQEYILAGSKLPIHNHYQLRLKRLESQQPGVDISVLKFSGSEAISDILRYEIEFTSAVKDIPARHIIN
YTALFLMYPDGKPWESVKPRIIPGVITQFRQCSTSADETRYVATLEHRVTRLNQGSNNAIYQNDSVISMT
ENTFLRYNMDRLDFRFALNDQYPLKKFMMQFGESEYAHIARRLADSGISYFFEYDEENNCDVMVLADHSY
AWPESVAIPFRNPAGMFDGGLESVWDMSVSRKSIPKSVTVNDDYYPAAQSDMTGTAETNPDYPALVAEDY
RWGEYYPEPGKEFSNEPGQGMWYTKRRQERYLSEQVTFEGKSNCMTLRPGMVITTPDKDWPEALDGLLIV
STNSKNVARDTAYFVTFTAVPRNTQHPYRPALLPWPTVTGTLPARISSAHPDEPYAHINADGLYRAQFGF
DRTEWQKGFESCWLRLAKPYSGDTCGFHMPLLDSTGVAIAFENGDVDRPYIACALHDSTHPDHVALPNYK
RNVIRTPSGNKIRLEDQRGKEHIKISTVHSGKSQLSLGHLVDSARKQRGEGAELRTDAYVAVRGGKGVLL
STEPKNSAQGQQLDMDAAIAQLEKALALAKTLKSTADIAQASPAETTDQELLKTDLTKLAQPGVVVYGDA
GIAHTTPKTIQQTAGKNLVATAGQDVSFSVFRRFSVAAGELFSVFANKLGIKLIAAAGKVQLQAQKDQME
LTSFEDMQITSTNGRIVLNAKKELLLMCGGAGIRIKDGTIEELAPTRITQKSPVLEYQGGDSVKQAMPSF
EEGKYAIQYRLHAEDDPTQVLKNQKFRIHRQDGSITEGATDANGESSLLHMNELENAAIELIKGL
 
Nucleotide Sequence: 2508 bp     [Download]
>gi|322835126|ref|NC_015062.1|:c383016-380509 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGAGCATTCAGGAATATATTCTTGCAGGCAGTAAATTACCGATCCACAACCATTACCAGTTGCGTCTTA
AAAGACTGGAATCCCAACAGCCCGGCGTTGATATTTCTGTGCTCAAATTCAGCGGCAGCGAGGCCATCAG
CGATATTCTGCGCTATGAGATTGAGTTTACCAGCGCGGTGAAAGACATTCCCGCCCGGCACATCATCAAC
TATACCGCCCTGTTTCTGATGTACCCCGACGGCAAGCCGTGGGAATCGGTTAAGCCACGCATTATCCCCG
GTGTGATCACCCAGTTTCGCCAGTGCAGCACTTCTGCTGATGAAACCCGTTACGTCGCCACGCTGGAGCA
CCGCGTCACCCGCTTAAATCAGGGCAGCAACAACGCGATTTACCAGAACGACAGCGTGATCAGCATGACC
GAAAACACCTTCCTGCGTTACAACATGGACCGGCTGGATTTTCGGTTTGCGCTCAATGACCAGTACCCGC
TGAAAAAATTCATGATGCAGTTTGGTGAAAGCGAATACGCCCATATTGCGCGACGCCTGGCTGATAGCGG
TATCTCCTACTTCTTCGAATATGACGAAGAGAACAACTGCGACGTGATGGTTCTGGCAGACCATTCATAC
GCCTGGCCTGAATCCGTTGCCATCCCGTTCCGCAACCCGGCGGGCATGTTTGACGGTGGCCTGGAATCAG
TCTGGGACATGTCGGTTAGCCGTAAATCAATCCCGAAATCTGTCACGGTTAACGACGATTACTACCCTGC
CGCGCAAAGTGATATGACCGGCACAGCGGAGACCAATCCCGATTATCCGGCGCTGGTCGCCGAAGATTAC
CGCTGGGGTGAGTACTATCCCGAGCCGGGCAAGGAATTCAGCAACGAGCCCGGACAGGGCATGTGGTACA
CCAAACGCCGTCAGGAACGTTACCTTAGTGAGCAAGTCACCTTTGAGGGCAAATCTAACTGTATGACGCT
GCGTCCGGGGATGGTCATCACCACGCCCGACAAAGACTGGCCGGAAGCGCTGGACGGTCTCCTGATTGTC
TCCACGAACTCTAAAAACGTCGCCCGCGATACTGCGTATTTCGTCACCTTCACCGCGGTTCCGCGTAATA
CTCAGCATCCGTACCGCCCTGCGTTGTTGCCGTGGCCGACCGTCACCGGCACGCTGCCTGCCCGTATCTC
CAGCGCGCATCCGGACGAACCTTACGCCCACATCAACGCCGACGGTTTGTACCGCGCCCAGTTTGGTTTC
GACCGCACCGAATGGCAGAAAGGCTTTGAGAGCTGCTGGCTACGTCTGGCGAAACCGTATTCCGGTGATA
CCTGCGGCTTCCATATGCCGCTGCTGGATTCCACCGGCGTGGCGATTGCCTTCGAAAATGGCGACGTTGA
CCGGCCTTATATCGCCTGTGCGCTGCATGATTCAACGCACCCGGATCATGTGGCGTTACCGAATTATAAG
CGGAACGTCATACGCACTCCTTCTGGAAATAAGATTCGACTTGAGGACCAGCGGGGCAAAGAACATATAA
AAATCAGCACGGTACATTCAGGTAAGAGCCAGCTCAGTCTGGGACACTTGGTGGACAGTGCCAGAAAGCA
ACGAGGTGAAGGCGCAGAATTGCGAACTGATGCCTATGTTGCCGTTCGCGGCGGTAAAGGCGTGCTGCTT
TCTACCGAGCCGAAGAACAGTGCTCAGGGACAGCAACTGGATATGGATGCCGCCATTGCCCAGCTTGAAA
AAGCCCTGGCTCTGGCCAAAACCCTGAAGAGTACCGCCGATATCGCTCAGGCGTCTCCGGCAGAAACCAC
CGATCAGGAGCTGCTCAAGACAGACCTCACCAAACTCGCTCAGCCAGGTGTCGTCGTCTATGGCGATGCC
GGTATTGCGCACACCACGCCGAAAACGATCCAACAAACTGCAGGTAAGAATCTGGTGGCCACCGCTGGCC
AGGATGTCAGTTTCAGCGTATTCCGTCGCTTCTCAGTTGCCGCCGGTGAACTGTTCTCCGTATTTGCGAA
CAAGTTAGGCATCAAGCTCATCGCCGCTGCAGGAAAGGTGCAGCTACAGGCGCAAAAAGACCAGATGGAG
CTGACCTCCTTCGAGGACATGCAGATCACCAGTACCAACGGCCGCATAGTGCTTAACGCCAAAAAAGAGC
TGCTGCTGATGTGTGGCGGGGCTGGGATCCGCATTAAGGATGGAACGATCGAAGAACTGGCACCGACCCG
TATTACCCAAAAATCACCGGTACTGGAGTATCAGGGTGGGGACAGCGTGAAGCAGGCGATGCCGTCATTT
GAAGAGGGCAAGTACGCCATTCAGTATCGTCTTCATGCTGAAGATGACCCGACTCAGGTGCTTAAAAATC
AGAAATTCCGTATCCACCGCCAGGATGGATCCATAACCGAAGGGGCTACGGATGCCAACGGCGAATCGTC
CTTACTCCATATGAACGAACTGGAAAATGCGGCGATTGAGCTAATTAAGGGACTATGA
 Primer design