SecReT6
Protein ID: 322835606
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4930
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]516003..519440 [+]
Producthypothetical protein
NoteTssM
UniProt IDE8Y094
KEGG IDrah:Rahaq_4930
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 8.50E-30, Aligned region: 184..346
ImcF-related_N [PF14331], Evalue: 8.50E-30, Aligned region: 350..370
ImcF-related_N [PF14331], Evalue: 8.50E-30, Aligned region: 768..806
ImcF-related_N [PF14331], Evalue: 8.50E-30, Aligned region: 1096..1137
Protein Sequence: 1145 a.a.     [Download]
>gi|322835606|ref|YP_004215632.1| hypothetical protein Rahaq_4930 [Rahnella sp. Y9602]
MFKKLLSFVAWTLFLCLLLIVCIVMSVVFEQTLLHALILWLILILAVLFSRFVWGSVSGMAQAKYISSLK
ARFKLTRLEYVLFEHWKTGAAVIKRIRRRKQPIPWFILTGGRSGKTTLMAGAGLPLFSNEPESSLVVPTR
TLRWWFFRSAGFLDLSSHFLNKTPAFERGWLRLVNRCARLPAPGGIVVCVSVSELLEKDDAELHLHARHI
RTQIEPLVSKVKRRLPVYLFITCCDRVPGFSHWANNLSAEQRQQPLGYYWRRSPVVDGKDPALLDPLFTC
VKDGLDKVRVSMLSGGEPDGDTLALMDFPEQLPKLQPALQRYLAALCEPDAYFQPAALGGIWFTATEPVS
KNSASRQAFFIHDLMARLLPELSRQREIEPVGFGRRYLHKWGAMTFSVLAITYVLFSGYFTNRLTGGSPA
QMDVTAQVQQLENIEHWNAHPLKYLPFVPVLNHRHTQLEASILAASPRDKVNLREIADNYQQLFTDADPQ
QKRELILNLASTLITKQAMWEKQPVSELIKQAPVPAALSMTGATVSLPYQQDVVLQRALLQLPEGGKQLV
VLRELLGRLVNSDPQMAWLVAPSGDLTPVNLTDFMPSSEDQTQVSGLWTLQGTAQIQGWLKEIRRAGGEQ
VPMPALVAFEQHWPALRQTQWMTMMLAMNQQPAPELTSEEWQTALITLDQGNSPSMKFSRYVNEQLEDIR
AQDAEPWLRELRRLNQLQAMSVPGALIPRISKVQQSFQKKISALLKIDSKTLTPVLSDLNVKNWNAWKNS
LHAAVSDVFATPKSSDRLTRGLFQTGAAGDSNPLQLLDSRFNVLRKNLSAERDDFASNAVWALYQNDAHW
LVAHAMQRSACWLEQQWQSRVLWPMENNASRLEYDDQQDLAWQYLSDFIRGPAKSVLVVEDNGPKAGEFN
GQTPGLTPEFLRMVNHVLRPDDVLAMPERENTRNDDALAALKDEQADLEAQMAALEAKPLELTLKSLPAT
IPGGARLMPVGTQLTLFCDEQQWKLNSMNFSEQAAFRWRPGHCSRATLVIKFPGFDLTYEYFGDAAWPDF
LQDISDGQHRFKAEDFPDDAAQLTALGIKEVMVRYQSGSQNAVQDRWHQWQELNQALNDNAEAQQETGLK
KAEKQRPTALKSAFSQLPVRITGCH
 
Nucleotide Sequence: 3438 bp     [Download]
>gi|322835126|ref|NC_015062.1|:516003-519440 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGTTTAAAAAATTACTTTCCTTTGTCGCATGGACACTATTTCTGTGCCTGTTACTTATTGTTTGTATTG
TCATGTCTGTTGTTTTCGAACAAACACTCCTGCATGCATTAATTTTGTGGCTGATATTGATCCTCGCCGT
TTTATTTTCCCGGTTTGTCTGGGGATCTGTTTCCGGTATGGCGCAGGCGAAATATATCTCCTCCCTGAAG
GCAAGATTTAAACTCACCCGGCTGGAATATGTTTTATTCGAACACTGGAAAACCGGGGCTGCGGTAATTA
AGCGCATCAGAAGACGCAAACAGCCAATACCCTGGTTTATACTCACTGGCGGGCGAAGTGGTAAAACGAC
GCTGATGGCCGGTGCAGGATTACCGCTGTTTTCTAATGAACCGGAAAGTTCTCTGGTTGTGCCGACCCGC
ACCTTACGCTGGTGGTTTTTTCGTTCCGCAGGTTTTCTCGACCTCTCCAGCCATTTTCTGAATAAAACCC
CGGCCTTCGAGCGCGGCTGGTTGCGTCTGGTGAACCGGTGTGCCCGTCTGCCTGCGCCGGGTGGCATCGT
GGTGTGCGTGTCGGTCAGTGAGTTGCTCGAAAAAGATGACGCGGAACTGCATCTGCATGCGCGGCATATC
CGCACGCAGATCGAACCGCTGGTCAGTAAAGTCAAACGCCGTCTGCCGGTGTATCTGTTTATCACTTGTT
GTGACCGGGTGCCCGGTTTCAGCCACTGGGCCAATAATCTCTCCGCCGAACAGCGCCAGCAACCGCTGGG
TTACTACTGGCGCCGTTCGCCTGTCGTCGACGGGAAAGATCCGGCCTTGCTGGATCCGCTGTTTACGTGC
GTGAAAGACGGGCTGGATAAAGTGCGTGTCAGCATGCTTTCGGGCGGCGAACCGGATGGCGACACGCTGG
CGTTGATGGATTTCCCTGAACAGCTACCGAAATTGCAACCTGCACTGCAACGTTATCTGGCCGCCCTGTG
TGAGCCGGACGCTTACTTTCAGCCCGCAGCACTGGGTGGTATCTGGTTTACCGCCACTGAACCTGTCAGC
AAAAACAGTGCTTCGCGTCAGGCTTTCTTTATCCATGACCTGATGGCCCGATTACTGCCTGAACTAAGCC
GCCAGCGTGAAATTGAGCCTGTCGGGTTTGGCCGTCGCTATCTGCATAAATGGGGGGCGATGACCTTCAG
TGTGCTGGCAATAACCTATGTGCTGTTTTCCGGTTATTTCACCAACCGCCTCACCGGGGGCTCGCCCGCG
CAAATGGATGTCACGGCGCAGGTTCAGCAGCTTGAGAACATTGAACACTGGAATGCACATCCGCTGAAAT
ATTTACCTTTTGTTCCCGTTCTCAACCATCGCCATACGCAGCTTGAGGCCAGCATTCTTGCTGCATCCCC
ACGCGATAAGGTGAACCTGCGGGAGATAGCAGATAACTACCAGCAGCTGTTCACCGACGCCGATCCACAG
CAAAAACGCGAGTTGATTCTGAACCTGGCAAGCACGCTTATCACTAAACAGGCCATGTGGGAAAAACAGC
CGGTCAGTGAGCTGATAAAACAGGCGCCGGTTCCGGCGGCGCTGAGCATGACCGGGGCCACCGTGTCCTT
ACCCTATCAACAGGATGTGGTGTTGCAACGCGCGCTGTTACAGTTGCCGGAAGGCGGCAAGCAACTTGTG
GTACTGCGCGAATTGCTCGGACGTTTGGTCAACAGTGATCCGCAGATGGCATGGCTGGTGGCTCCTTCAG
GCGATCTGACGCCAGTGAATCTGACGGATTTCATGCCCTCGTCTGAGGATCAAACGCAGGTCAGTGGTCT
GTGGACGCTACAGGGCACCGCACAAATTCAGGGCTGGTTGAAGGAAATCCGTCGCGCAGGAGGTGAACAG
GTCCCGATGCCTGCGCTAGTGGCTTTTGAACAGCACTGGCCTGCGCTGCGCCAGACGCAATGGATGACGA
TGATGCTGGCGATGAACCAGCAACCCGCCCCGGAGCTGACCAGCGAAGAGTGGCAAACCGCGCTGATTAC
GCTCGATCAGGGTAACAGCCCATCAATGAAATTTTCCCGTTACGTCAATGAACAACTAGAAGACATCCGT
GCTCAGGATGCCGAGCCCTGGTTGCGCGAGCTGCGCCGGTTGAATCAGTTACAGGCTATGTCGGTACCCG
GTGCGCTGATACCGCGTATCAGCAAGGTCCAGCAGTCTTTTCAGAAGAAAATTTCAGCACTGCTGAAAAT
CGACAGCAAAACCCTGACACCCGTGCTTTCCGATCTCAATGTGAAAAACTGGAATGCCTGGAAAAACAGT
CTGCATGCGGCGGTTTCGGACGTGTTTGCTACGCCGAAAAGCAGCGATCGTCTGACGCGCGGACTGTTCC
AGACCGGCGCGGCGGGCGACAGCAATCCACTGCAATTACTCGACAGCCGTTTTAACGTGCTGCGTAAGAA
CCTGTCGGCGGAACGCGATGATTTTGCCTCCAACGCGGTGTGGGCGTTGTATCAGAATGATGCGCACTGG
CTGGTGGCGCATGCCATGCAGCGTTCTGCCTGCTGGCTTGAACAGCAATGGCAGAGCCGGGTGCTGTGGC
CAATGGAAAATAATGCCAGCCGTCTGGAGTACGACGACCAACAGGATCTGGCGTGGCAATACCTGTCTGA
CTTTATCCGGGGACCGGCAAAAAGTGTGCTGGTGGTTGAAGATAACGGGCCAAAAGCGGGCGAATTCAAC
GGGCAGACACCGGGCCTGACACCGGAATTTCTGCGAATGGTCAATCACGTGTTGCGTCCGGATGACGTGC
TGGCGATGCCGGAACGTGAAAATACCCGCAATGACGATGCGCTGGCCGCCCTGAAAGATGAGCAGGCCGA
TCTGGAGGCTCAAATGGCGGCACTGGAAGCAAAACCGCTGGAACTGACGCTTAAAAGCCTGCCTGCCACC
ATTCCCGGCGGTGCGCGGCTGATGCCGGTGGGCACTCAGTTGACGCTGTTCTGCGATGAGCAACAGTGGA
AGCTCAATAGCATGAACTTCAGCGAACAGGCGGCATTCCGCTGGCGTCCGGGGCATTGCAGTCGTGCCAC
GCTGGTGATCAAGTTCCCTGGTTTCGATCTGACGTACGAATACTTCGGCGACGCCGCATGGCCTGATTTC
CTGCAGGACATTTCCGACGGGCAGCATCGTTTCAAAGCGGAAGATTTCCCGGATGATGCCGCTCAGCTGA
CGGCACTGGGCATCAAAGAAGTCATGGTGCGTTATCAGAGCGGCTCACAGAACGCGGTGCAGGATCGCTG
GCATCAGTGGCAGGAACTCAATCAGGCACTGAATGACAACGCTGAGGCGCAGCAGGAAACCGGCCTTAAA
AAAGCGGAAAAACAACGACCGACAGCGCTGAAAAGTGCGTTCTCGCAACTGCCTGTCCGCATTACCGGAT
GTCACTGA
 Primer design