SecReT6
Protein ID: 323524557
SecReT6 ID507
T6SS typei3
Gene symbol-
Locus tagBC1001_0185
StrainBurkholderia sp. CCGE1001
Repliconchromosome I [GenBank: NC_015136] [Browse all T6SS(s) in this replicon]
Location [Strand]207295..211407 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDE8YKS2
KEGG IDbug:BC1001_0185
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.60E-98, Aligned region: 646..966
ImcF-related_N [PF14331], Evalue: 2.40E-91, Aligned region: 309..599
DUF1215 [PF06744], Evalue: 3.60E-33, Aligned region: 965..993
DUF1215 [PF06744], Evalue: 3.60E-33, Aligned region: 1079..1202
Protein Sequence: 1370 a.a.     [Download]
>gi|323524557|ref|YP_004226710.1| type VI secretion protein IcmF [Burkholderia sp. CCGE1001]
MKKFLSFVGSRQFLALVALCVVALAIWFIGPFLSFGGLKPLAGAGMRVTVIALLLAGVLLWLANLSTSVV
FVVLLGLLVWYASPLLAFGAAKPFAAESARIIAIAVLAGLFFSYWVFRLLRKMHAEPQYFDRLFSLGRAS
EPSLATERLETVSAAFNGALARLKSMRTGARGPGRLFQGKRYLYELPWYIALGSNESGKTAALLRAGLTF
PVAGQMQRAAHGFMERTRNVDWWLCNEAVLIDTAGHYTRHGTSRGELPAVDKAQAAAAADTGEVNPDKGK
DKTAAASTGGAPSGVTSTSMSADFEDLRRDTDEAEWQGFLGLLRSHRPRAPINGALLTVDLARLTADDER
ARMAEAAALRARLTELRESLGIRFPVYLLITKMDQLSGFAEYFGSLPAEGRAQTWGFTLPYGQETIAREG
IAAQCSEELRLLAARLADGINTRLHDEHDARRRQKLVVLGDEFAALSAPLGELIEHLFVDSRYDDTQLHA
TLRGVYFTSTTQPGEQIIAERRSIAQRLAAALRHAAGMAPVMSMDAGAQPAGVPFANSLAAQRAGNESYF
LHDLLTKVVFPEAHLVRPNLRWEFRFRLLRLIGHALAVLLFAWLAIGLRVSFGHNSAYLDAIERKTQALS
AKVTQLYREPRPEAVPDTLTDARYLASQRGLDLSNPETDYRYGLYTGSDVAAESRGTYEALQDNLLLPQL
VKRMESALSGAIAAHDPKAAYDTLRVYLMLHDKTRFSADDVKAWVLDDWAKTDSAAVFGGRASMIDHVQQ
LFSGSRAVQSPFVRNDALIQQARSFLDSSNATQRLYERAKAAMQKEAPDEFTLLRAVGPQAGTVFTRASG
APLSRGVPGIFTFDGYRELFDKRLPEFVQVARDDDAWVMGRSLLGDAQKKTLEIVSSATGADDPLTEAIR
RQYLNEYAQQWDAFLADIHTVSGTSLAFDLQVLRSLAAPDSPLSRLARAAVHETTLAEPLAPAEASLIQK
ATGQIAQKADSTLGIRAEERTERELVDSHFAALREVVTGSTNVPANAPGAQSVSAQAGRTGLDGVANILN
DYYTALTVADNALTNNSMPPASDVAARLKMTAGTMPAPFRYVLLQLAQQGSQEVNHGIGQLLSRQMQAVV
GDTCRLAIEGNYPFAKDSPRDVSIDDFTRVFAQGGVIDDFFLKTLAPFVDTSARPWRYRTLPGATDAVQG
PDLEPFEHAKAIREVFFGEAGQKQLAWKATIQIPDLDPTITGLMIDLDGQTMLYQHGPVQPFSLTWPGPR
GGVHAEMTASPRIRSETSTISTDGPWALMRLVQKGHASDTATPGRTRITFDFDGRKAVLDVASAGSVQNP
LTSDVWKTFRCPSSMPAFTLTDSGPPPGLPPAGAIAAMPR
 
Nucleotide Sequence: 4113 bp     [Download]
>gi|323524377|ref|NC_015136.1|:207295-211407 Burkholderia sp. CCGE1001 chromosome 1, complete sequence
ATGAAGAAGTTTTTGTCGTTTGTGGGGTCGCGCCAGTTTCTCGCTCTCGTCGCGCTGTGCGTAGTTGCAC
TCGCGATCTGGTTCATCGGGCCGTTCCTCTCGTTCGGCGGTCTGAAGCCGCTCGCCGGCGCCGGCATGCG
GGTGACGGTGATCGCGCTGCTTCTGGCGGGCGTTCTGCTGTGGCTCGCGAACCTGTCGACCAGCGTGGTG
TTCGTGGTTTTGCTGGGCCTGCTGGTCTGGTATGCGTCGCCGCTCCTTGCATTCGGCGCGGCAAAGCCGT
TTGCGGCCGAGTCGGCGCGGATCATTGCGATTGCGGTTCTCGCTGGTTTGTTCTTCTCCTATTGGGTGTT
CCGGCTTTTGCGGAAAATGCATGCCGAGCCGCAATACTTCGATCGCCTGTTTTCTCTCGGTCGTGCGAGC
GAGCCGTCCCTTGCAACGGAGCGTCTCGAGACGGTCAGCGCCGCGTTCAATGGCGCGCTCGCGCGTCTGA
AGTCGATGCGGACAGGCGCCCGCGGGCCGGGGCGCCTGTTTCAGGGTAAGCGCTATCTATACGAACTGCC
GTGGTACATCGCGCTTGGCTCGAACGAATCGGGCAAGACTGCAGCGCTGCTGCGCGCGGGCTTGACCTTT
CCCGTCGCCGGACAAATGCAGCGTGCCGCGCACGGTTTCATGGAGCGCACGCGCAATGTCGACTGGTGGC
TGTGCAACGAGGCCGTGCTGATCGATACGGCAGGCCACTATACCCGACACGGTACGTCGCGCGGCGAACT
GCCTGCCGTTGACAAGGCGCAAGCGGCCGCCGCCGCAGACACCGGCGAAGTCAATCCGGACAAAGGCAAA
GACAAGACTGCAGCGGCGTCTACCGGCGGCGCACCGTCCGGGGTGACGTCCACGAGCATGAGCGCCGATT
TCGAAGACCTACGCCGCGACACCGACGAAGCCGAGTGGCAAGGCTTTCTCGGCCTGCTGCGCAGCCACCG
TCCGCGCGCGCCCATCAACGGAGCTCTGCTGACGGTCGATCTCGCCCGGCTTACCGCCGATGATGAGCGC
GCCCGGATGGCCGAGGCGGCCGCGCTGCGCGCACGGCTTACGGAACTGCGCGAATCGCTGGGCATCCGCT
TTCCGGTCTATCTGCTCATCACCAAGATGGATCAATTGAGCGGCTTTGCCGAGTATTTCGGCTCCCTGCC
CGCCGAGGGGCGCGCCCAGACCTGGGGATTCACGCTGCCGTACGGGCAGGAGACTATCGCGCGCGAAGGG
ATCGCGGCACAGTGCAGCGAGGAACTGCGCCTGCTCGCTGCGCGCCTCGCCGACGGCATCAACACGCGCT
TGCACGACGAGCACGACGCACGCCGACGCCAGAAACTCGTCGTACTTGGCGACGAGTTTGCCGCGCTGAG
CGCGCCGCTTGGCGAACTGATCGAGCATTTGTTCGTCGATTCACGGTACGACGACACGCAGTTGCATGCC
ACCTTGCGCGGCGTTTACTTCACCAGCACGACACAACCGGGCGAGCAGATTATCGCCGAGCGGCGCAGCA
TCGCGCAGCGGCTCGCCGCCGCGCTCAGGCATGCGGCTGGCATGGCACCTGTCATGTCGATGGATGCCGG
AGCACAACCCGCCGGCGTCCCGTTCGCAAACTCACTCGCGGCGCAGCGCGCCGGCAACGAAAGCTACTTC
CTGCACGACCTGCTGACCAAGGTGGTGTTCCCCGAAGCGCATCTCGTGCGCCCGAATCTGCGGTGGGAAT
TCCGCTTCAGACTGCTGCGGCTGATCGGTCACGCCCTTGCAGTGCTTCTGTTTGCATGGCTGGCTATCGG
GCTGCGTGTCAGCTTCGGTCACAACAGCGCCTATCTCGACGCAATCGAACGTAAGACTCAGGCGCTCTCG
GCGAAGGTCACGCAGCTTTACCGAGAGCCGAGGCCCGAGGCGGTACCCGATACCCTGACCGATGCTCGCT
ACCTGGCGAGTCAACGCGGTCTCGATCTGTCGAACCCGGAGACCGATTATCGCTACGGCCTCTATACCGG
TTCGGATGTCGCCGCCGAGAGCCGCGGTACTTACGAAGCGCTGCAGGACAATCTGCTCCTGCCGCAACTC
GTCAAGCGTATGGAATCCGCACTGTCCGGCGCGATCGCGGCCCATGATCCGAAAGCCGCATACGACACGT
TGCGCGTCTATCTCATGCTTCACGACAAGACGCGCTTCAGCGCCGACGATGTCAAAGCGTGGGTGCTCGA
CGACTGGGCGAAGACCGATAGTGCGGCTGTGTTCGGCGGACGGGCGTCGATGATCGACCATGTGCAGCAG
CTTTTCTCTGGCTCGCGCGCTGTGCAGTCGCCTTTCGTCCGCAACGACGCGCTGATTCAGCAGGCCCGCT
CATTTCTCGACAGCAGCAATGCTACTCAGCGGCTCTACGAGCGCGCCAAAGCGGCCATGCAGAAAGAGGC
GCCCGACGAATTCACGCTCCTGCGCGCGGTCGGCCCGCAGGCGGGCACCGTGTTCACGCGCGCGAGCGGC
GCGCCGCTTTCCCGCGGCGTGCCGGGCATTTTCACGTTCGACGGCTATCGCGAGTTGTTCGACAAGCGGC
TGCCCGAATTCGTGCAGGTCGCTCGAGACGACGATGCATGGGTGATGGGCCGCTCGTTGCTCGGGGACGC
TCAAAAAAAAACGCTTGAGATCGTGAGTTCTGCCACCGGCGCCGACGACCCGCTGACGGAAGCGATCCGC
CGTCAGTATCTGAACGAATATGCGCAGCAATGGGACGCGTTTCTTGCCGACATACACACGGTTAGCGGCA
CGAGCCTCGCATTCGATCTTCAGGTGCTGCGCAGCTTGGCGGCGCCGGACTCACCGCTCTCGCGCCTCGC
GCGCGCGGCGGTTCATGAGACCACGCTGGCGGAGCCGCTGGCGCCGGCCGAAGCGTCGCTGATCCAGAAG
GCGACCGGGCAGATCGCGCAGAAAGCGGACAGCACGCTCGGCATACGCGCGGAGGAACGAACTGAGCGCG
AACTCGTCGACAGTCATTTTGCGGCGCTGCGTGAGGTCGTCACCGGTAGTACGAACGTCCCGGCAAATGC
GCCAGGCGCGCAGTCGGTTTCCGCCCAGGCTGGCAGAACTGGGCTGGACGGCGTGGCGAATATTCTCAAC
GACTATTACACCGCGCTCACCGTCGCGGACAACGCACTCACCAATAACAGCATGCCGCCTGCGAGCGACG
TGGCCGCGAGACTGAAAATGACCGCGGGCACCATGCCTGCGCCGTTTCGCTATGTGCTGCTGCAGCTGGC
ACAGCAAGGTTCGCAGGAGGTGAATCACGGCATCGGCCAGCTTCTGTCGCGGCAGATGCAGGCCGTGGTC
GGCGACACCTGCCGTCTCGCGATCGAGGGGAACTATCCGTTCGCGAAAGACAGCCCGCGCGACGTGAGTA
TCGACGACTTCACGAGGGTGTTCGCTCAAGGCGGCGTGATCGACGATTTCTTTTTGAAAACGTTGGCGCC
GTTTGTCGACACCTCGGCGAGACCCTGGCGTTACCGGACGCTGCCGGGCGCAACCGATGCGGTTCAGGGA
CCCGATCTCGAACCGTTCGAGCACGCGAAGGCCATTCGTGAGGTCTTCTTCGGCGAGGCGGGGCAGAAGC
AGCTTGCCTGGAAGGCGACAATTCAAATTCCCGATCTGGATCCCACGATTACCGGACTGATGATCGACCT
GGACGGCCAGACGATGCTCTATCAGCACGGGCCCGTACAGCCGTTCTCTTTGACATGGCCGGGGCCGCGC
GGCGGCGTGCACGCGGAGATGACTGCGAGCCCGCGCATTCGTTCCGAAACGTCCACCATATCAACCGACG
GCCCATGGGCGCTGATGCGCCTCGTGCAAAAAGGTCACGCGAGCGACACGGCCACGCCCGGCCGCACGCG
CATCACATTCGACTTCGACGGGCGCAAGGCGGTACTCGATGTAGCCAGCGCAGGTAGTGTGCAAAATCCG
CTGACGAGCGATGTGTGGAAAACGTTCCGTTGCCCGAGTTCGATGCCTGCGTTCACGCTGACTGATAGCG
GACCGCCGCCGGGATTACCGCCCGCTGGTGCGATTGCCGCCATGCCGCGCTGA
 Primer design