SecReT6
Protein ID: 323529929
SecReT6 ID508
T6SS typei4b
Gene symbol-
Locus tagBC1001_5647
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2301766..2305641 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDE8YV86
KEGG IDbug:BC1001_5647
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.80E-71, Aligned region: 190..450
IcmF-related [PF06761], Evalue: 3.40E-55, Aligned region: 495..847
DUF1215 [PF06744], Evalue: 1.50E-27, Aligned region: 979..1094
Protein Sequence: 1291 a.a.     [Download]
>gi|323529929|ref|YP_004232081.1| type VI secretion protein IcmF [Burkholderia sp. CCGE1001]
MRRFFNVLTHPRTLSIIGLLALAAVLFVGADTLQIDLMWPAIALAALVALWLLVWVVRRLRARRANDKLG
EMLEQQAEKQSADAGPAPTPARQAELDVLRTRLVDAVKTIKTSKIGQLSGGSALYELPWYIVIGNPAAGK
SSAVLNSGLQFPFADKNNAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRTEWLGFLGLLKKFRPK
APINGIIVTASIAELTSSKPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSGSDRH
EYDRVWGATLPYEPDEKRDVVGLFDEHFEELYDGLKEISVAQMSINRGNKLSPGQLSFPLEFSTIKPALR
AFLATLFETNPFQYKPIFRGFYFTSALQEGETSSAAATRIANRFGLSAESMPKPQSAFSKNGFFLRDLFS
KVIFADRQTVRQFASPAKTRMRYATFFGFVAVLALALGGWTWSTVNNQQLAENVKADLDNVVRLQQNRND
LQSRLQAMDVLEDRIDQLEQFRRDKPLAVSLGLYQGDRLEQRLLTEYYNGVRQILLDPVSQNLASFLKDV
NAHPDQLAPLNRTPDAAAIPVSTHSAMTASGQGGLYSDASPTNVEDAYNALKTYLMLSDKRHVETAHLTD
QVARFWRGWLETNRGNMPRDEMIRSAERMITFYLSRVSDDDWPMIDQNLGLVDQTRENLRRVVRGMPARQ
RVYEEIKARASTRFAPMTIARIVGENNTALVAGSYAIPGTFTREAWFQYVQPAIREAATKELQAKDWVLN
TSAHDDLTLEGSPEQIQKALVTMYKTEYAMHWQKFMQGIAVQSFGSFGQAVDAMNRLGDPQDSPIRKVLE
TAYDQTSWDNPSLFNASLKRAQSGVTSWFKQWFSRAPTGQLNANIDINGNPVEMPMGPIGQEFSALGRIV
QTGDNGSMLKGYMDTLSKVRTRFNVIKNQGDPGPGARQLMQQTLDGSGSELADSLKYVDEQMLTGLTDSQ
RKALRPLLVRPLMAAYAVVIQPASVEVNKVWNAQVYQTFQNSLASKYPFSGDAKVEAGAGEIAQVFGPDG
SIAKFVGTTLGPLAVRRGDTLTARTWGDMGLALTPDFTNGFARWVAPLAGGAAGASAGQSSAEPQTVFQI
LPQPSSGTTEYTLAIDGQQMRYRNTPPQWTNFVWPNPSGSPGATLSATTFDGRTLQLVNEPGRYGLEKLI
NSAQRKRRPDGTFDLSWTQGNVTVAVSMRIISTSQASGGSSDAPQQQSLRGLRLPSSVADVSAAANSVAA
TNTASSAAPVASAVPAARPATAAVSNTGGAQ
 
Nucleotide Sequence: 3876 bp     [Download]
>gi|323527923|ref|NC_015137.1|:c2305641-2301766 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGCGACGCTTTTTCAACGTGTTGACCCATCCACGCACGCTCTCGATCATCGGCCTGCTCGCGCTCGCTG
CGGTCCTCTTCGTCGGCGCCGATACACTGCAGATCGACCTGATGTGGCCGGCCATCGCGCTCGCTGCGCT
CGTCGCGCTATGGCTGCTCGTATGGGTGGTGCGCCGCCTGCGCGCGCGTCGCGCGAACGATAAGCTCGGC
GAAATGCTCGAGCAGCAGGCGGAAAAGCAGAGCGCCGACGCGGGACCGGCGCCCACGCCGGCGCGCCAGG
CGGAACTCGACGTGCTGCGCACGCGCCTCGTCGACGCGGTCAAAACCATCAAGACTTCGAAGATCGGCCA
GCTGTCGGGCGGCTCGGCCTTGTATGAACTACCGTGGTACATCGTGATCGGCAATCCCGCCGCGGGCAAA
AGCAGCGCCGTGCTGAACTCGGGCTTGCAATTCCCGTTCGCCGACAAAAACAACGCGGTGATCCACGGCA
TTGGCGGCACGCGCAATTGCGACTGGTTCTTCACGACAGAGGGCATTCTGCTCGACACGGCAGGACGCTA
CTCCGTGCATGAGGAAGACCGTACCGAATGGCTCGGGTTTCTCGGCCTGCTCAAGAAGTTCAGGCCCAAA
GCGCCGATCAACGGCATCATCGTGACCGCGAGCATTGCGGAACTCACCAGCAGCAAGCCTGAATTCGCCA
TCAATCTTGCGAAGAACCTGCGCCAGCGCGTGCAGGAATTGACCGAAAAGCTGGAGGTGTTCGCGCCGGT
CTACGTGATGTTCACCAAGGCCGACCTGATCACAGGCTTCACCGAATTCTTCAGCGGCAGCGACCGTCAC
GAATACGACCGCGTGTGGGGTGCCACCCTGCCCTACGAGCCGGACGAAAAGCGCGACGTGGTCGGCCTTT
TCGACGAACACTTCGAAGAACTCTATGACGGCCTGAAAGAAATCAGCGTCGCGCAGATGTCGATCAACCG
CGGCAACAAGCTCTCGCCAGGCCAACTGAGCTTCCCGCTCGAATTCTCCACGATCAAGCCCGCGCTTCGC
GCCTTTCTCGCCACGCTGTTTGAAACAAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCTTCTATTTCA
CGAGCGCCTTGCAGGAAGGCGAAACCAGCAGCGCCGCGGCCACGCGCATCGCGAACCGCTTCGGCCTGAG
CGCCGAAAGCATGCCGAAGCCGCAGAGCGCGTTCTCAAAGAACGGGTTCTTCCTGCGCGACCTCTTTTCC
AAGGTCATCTTCGCGGACCGGCAAACGGTCAGGCAATTCGCCAGCCCCGCGAAGACGCGCATGCGCTACG
CAACGTTTTTCGGCTTCGTCGCCGTGCTCGCGCTGGCGCTCGGCGGCTGGACATGGTCGACCGTCAACAA
TCAGCAACTCGCGGAGAACGTCAAGGCCGATCTCGACAACGTCGTGCGTTTGCAGCAGAACCGCAACGAC
CTGCAATCGCGACTGCAGGCAATGGACGTGCTCGAAGACCGTATCGATCAGCTCGAACAGTTCCGCCGCG
ACAAGCCGCTCGCTGTTTCGCTCGGCCTGTATCAGGGCGATCGTCTCGAACAGCGTCTTCTGACCGAGTA
CTACAACGGCGTGCGTCAGATTCTGCTGGATCCGGTTTCGCAGAACCTCGCGTCGTTCCTGAAGGACGTC
AACGCGCATCCGGATCAGCTCGCGCCGCTCAATCGCACACCGGACGCCGCCGCGATTCCCGTCTCGACGC
ATAGCGCCATGACGGCGAGCGGCCAGGGCGGCCTTTACAGCGACGCGTCGCCTACCAATGTGGAAGACGC
ATACAACGCGCTCAAGACGTACCTGATGCTCAGCGACAAGCGTCACGTGGAAACGGCTCACCTGACCGAC
CAGGTGGCGCGTTTCTGGCGCGGCTGGCTCGAAACGAATCGCGGCAACATGCCTCGCGACGAAATGATCC
GCAGCGCCGAGCGCATGATCACCTTTTACCTGTCCCGCGTGTCCGACGACGACTGGCCGATGATCGACCA
GAACCTCGGCCTCGTCGATCAGACTCGCGAGAACCTGCGTCGCGTGGTGCGCGGCATGCCGGCGCGTCAG
CGCGTCTATGAGGAGATCAAGGCGCGCGCCTCCACCCGCTTTGCGCCGATGACCATCGCGCGCATCGTCG
GTGAGAACAATACGGCGCTCGTGGCGGGCAGCTACGCGATTCCCGGCACATTTACGCGGGAAGCGTGGTT
CCAGTATGTGCAGCCCGCGATTCGCGAGGCGGCGACGAAGGAATTGCAGGCGAAAGACTGGGTGCTCAAC
ACCTCCGCGCATGACGACCTGACGCTCGAAGGCAGCCCCGAGCAGATCCAGAAAGCACTGGTCACGATGT
ACAAGACCGAGTATGCAATGCACTGGCAGAAGTTCATGCAAGGCATCGCGGTGCAGAGCTTCGGCAGCTT
CGGGCAGGCTGTGGACGCGATGAACCGCCTCGGCGACCCGCAGGATTCGCCGATCCGCAAAGTACTCGAA
ACCGCGTATGACCAGACTTCGTGGGACAACCCGTCGCTCTTCAACGCGAGCCTGAAACGCGCGCAAAGCG
GCGTGACGAGCTGGTTCAAGCAATGGTTCTCGCGCGCGCCGACCGGCCAGCTGAACGCGAACATCGACAT
CAACGGCAATCCGGTGGAAATGCCGATGGGTCCCATCGGACAGGAATTTTCCGCGCTGGGGCGTATTGTC
CAGACGGGCGACAACGGCTCGATGCTCAAGGGCTATATGGACACGTTGTCCAAGGTCCGCACGCGCTTTA
ACGTCATCAAGAACCAGGGCGATCCGGGACCGGGCGCGCGTCAGCTCATGCAGCAGACGCTCGACGGGAG
CGGCTCCGAACTCGCGGATTCGCTCAAGTATGTCGACGAGCAGATGTTGACGGGCCTCACCGATTCGCAG
CGTAAAGCCCTGCGTCCGCTGCTCGTACGCCCTTTGATGGCCGCGTACGCCGTGGTGATCCAGCCTGCCA
GCGTCGAAGTCAACAAGGTGTGGAATGCACAGGTGTACCAAACATTCCAGAACTCGCTCGCCAGCAAATA
TCCGTTTTCCGGCGACGCGAAGGTGGAAGCCGGTGCTGGTGAAATCGCACAGGTGTTCGGACCGGACGGC
TCGATTGCGAAGTTCGTCGGCACCACGCTCGGGCCGCTCGCGGTGCGCCGCGGCGACACGCTGACAGCGC
GCACATGGGGCGACATGGGCCTCGCGCTCACGCCGGACTTCACGAATGGGTTCGCGCGCTGGGTCGCGCC
GCTTGCGGGCGGTGCAGCGGGCGCCTCGGCAGGCCAGAGCTCGGCGGAACCGCAGACCGTGTTCCAGATC
CTGCCGCAGCCGAGCAGCGGCACGACCGAGTACACGCTCGCCATCGACGGCCAGCAGATGCGTTACCGCA
ACACGCCGCCGCAATGGACCAACTTCGTGTGGCCGAATCCGTCGGGGTCGCCCGGCGCCACGCTGTCGGC
CACGACCTTCGACGGACGCACCTTGCAACTCGTCAACGAACCGGGCCGCTACGGTCTCGAGAAGCTGATC
AATTCGGCGCAGCGCAAGCGTCGCCCGGACGGCACCTTCGATCTGTCGTGGACGCAAGGCAACGTGACGG
TGGCGGTCAGCATGCGCATCATCAGCACGTCGCAAGCCTCGGGCGGCAGCAGCGACGCGCCGCAGCAGCA
AAGCCTGCGTGGGCTGCGTCTGCCTTCTTCGGTGGCGGACGTAAGCGCGGCGGCCAATTCCGTCGCTGCC
ACGAACACAGCCAGTAGTGCGGCGCCCGTCGCGTCGGCGGTGCCGGCGGCGCGGCCGGCCACGGCCGCGG
TTTCGAACACAGGAGGTGCGCAATGA
 Primer design