SecReT6
Protein ID: 326316329
SecReT6 ID509
T6SS typei3
Gene symbol-
Locus tagAcav_1512
StrainAcidovorax avenae subsp. avenae ATCC 19860
Repliconchromosome [GenBank: NC_015138] [Browse all T6SS(s) in this replicon]
Location [Strand]1683981..1687613 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDF0Q332
KEGG IDaaa:Acav_1512
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.90E-95, Aligned region: 518..833
ImcF-related_N [PF14331], Evalue: 4.50E-94, Aligned region: 205..470
ImcF-related_N [PF14331], Evalue: 4.50E-94, Aligned region: 1063..1075
DUF1215 [PF06744], Evalue: 1.90E-33, Aligned region: 947..1070
FtsK_SpoIIIE [PF01580], Evalue: 0.0025, Aligned region: 141..156
FtsK_SpoIIIE [PF01580], Evalue: 0.0025, Aligned region: 420..441
Protein Sequence: 1210 a.a.     [Download]
>gi|326316329|ref|YP_004234001.1| type VI secretion protein IcmF [Acidovorax avenae subsp. avenae ATCC 19860]
MLRKIFSFFFNRITLVLCGLVLLSLLVWFVGPLVYIKPYQPLESEAVRGWIIAALFGIWFLRLFIRWWRA
KEMNARLLGQLARIGASDASTPEAGPGKEEVAELEKRFKEAVDVLGKTRFGQAEQGWFGRLSRRYVYQLP
WYLIIGSPGSGKTTALVNSGLDFPLAAQFGKASIRGVGGTRNCDWWFTDQAVLLDTAGRYTTQESDAAQD
SAAWSGFLNLLRRFRGRQPINGVLVTLSVQELLSGGDAERERLARLIGLRLAELCEGLSIKFPVYVLVTK
TDLLAGFNEFFGNMTREERAQVWGFTNPYVEGQAQEDPGVQFRKEFDGLADQINRLLPQRLLAEPDLARR
GQIYGLPQQFVGLRDVVQQTLSTIFASSRFKEKPLFRGVYFTSGTQEGMPFDRVLSALSRRFSVSPPANL
AGEGRAGKSYFIETLLKGVIFNEAGLTGRNAKKERQLRLLQAAGFFALAAGLAGATIAWTISHGNNQKYL
DEVAAKVPTLKQAVEESRDADPENMVALLPLLNHAESLATSQRYTGDSPPLSWRYGLLQVPKVQTAADAT
YMRLLEDAWLPRLARHLRNSLQQASTANPEASYEALKVYLMLYDPERFNPRVVKAWMLNEWESTLPPALV
QSGMLDQLAHHLDRLMEDRALVSPIPIDQPLVDEVRQRLAQLSPAQRAYSRLKQLLTTGTALPPDFTLVR
AAGPEAPQVFTRRSGKPLTQGISGLFTYDGYYGVFSHELPKVTALLAQEETWVLGKAQGQRSVANEVMTG
QLALEVKRLYLMEYAKVWEDFLADVRPVQMASLDQAGEQARLYSSANSSLEQFIRAVAKETTLGQKPGAG
GSSTSSWLGEKINRIKEEQEQLSRLTGKRVNVGGLAATSSNLEADLVDFRFREYRRLAASNGSGPAPITA
SLQVLNEAAAVISSARQQISAGGTVPASLSPALERVRMEAKRVPPPLNTMYEDLASSTSALVGRDVRATV
GSNLNATIGTFCRRAIGGRYPFTKGSSSDVTSDDFASLFSPGGMMDEFFRNTLQPMVDISATPWRFRQGV
DGTPVGGSAALASFQRAATIRDVYFRAGGKVPSIRMDIKPLEMDASISQMVLDIDGEVLRYQHGPQIPKS
MTWPGTRGTGQVRLQLTGGGAENTGLVTEGPWAVHRFFDKAQILPGSTPERFVAAFDIGGRKLRFEVTTG
SVLNPFRLKAMEEFACPGNL
 
Nucleotide Sequence: 3633 bp     [Download]
>gi|326314823|ref|NC_015138.1|:1683981-1687613 Acidovorax avenae subsp. avenae ATCC 19860 chromosome, complete genome
ATGCTGCGCAAGATCTTTTCTTTCTTCTTCAACCGGATCACGCTGGTGCTGTGCGGCCTGGTGCTGCTCA
GCCTGCTAGTCTGGTTCGTCGGTCCGCTGGTCTATATCAAGCCCTATCAGCCCCTCGAAAGCGAGGCGGT
GCGCGGCTGGATCATCGCCGCGCTGTTCGGCATCTGGTTCCTGCGCCTGTTCATCCGTTGGTGGCGTGCC
AAGGAGATGAACGCACGCCTGCTGGGCCAGCTGGCCCGCATCGGGGCGTCGGATGCCTCCACTCCCGAGG
CCGGCCCCGGCAAGGAAGAGGTGGCCGAACTCGAGAAGCGCTTCAAGGAGGCGGTCGATGTCCTGGGCAA
GACGCGTTTCGGACAAGCGGAGCAGGGGTGGTTCGGGCGCCTGTCGCGGCGCTATGTCTACCAGTTGCCC
TGGTACCTCATCATCGGCTCGCCGGGCTCGGGCAAGACCACGGCACTGGTCAACTCGGGCCTCGACTTTC
CGCTGGCCGCCCAGTTCGGCAAGGCGTCGATCCGTGGCGTCGGCGGCACGCGCAACTGCGACTGGTGGTT
CACCGACCAGGCCGTCCTGCTGGACACCGCCGGCCGCTACACCACGCAGGAAAGCGACGCGGCACAGGAC
AGTGCCGCATGGTCGGGTTTCCTGAACCTGCTGCGGCGCTTCCGCGGACGCCAGCCCATCAACGGCGTGC
TGGTGACGCTCAGCGTGCAGGAGCTGCTGAGCGGCGGCGATGCGGAGCGCGAGCGCCTGGCCCGGTTGAT
CGGCCTGCGCCTGGCGGAGCTGTGCGAGGGCCTGTCCATCAAGTTCCCGGTGTACGTGCTGGTCACCAAG
ACCGACCTGCTGGCGGGCTTCAATGAGTTCTTCGGGAACATGACCCGCGAGGAGCGGGCCCAGGTCTGGG
GCTTCACCAATCCCTACGTGGAAGGGCAGGCGCAGGAAGATCCGGGAGTGCAGTTCCGCAAGGAATTCGA
CGGCCTGGCCGACCAGATCAACCGGCTGCTGCCGCAGCGGCTGCTGGCCGAGCCCGACCTGGCGCGGCGC
GGCCAGATTTACGGCCTGCCGCAGCAGTTCGTCGGGCTGCGGGACGTGGTCCAGCAGACGCTCTCGACGA
TCTTCGCCTCTTCGCGGTTCAAGGAGAAGCCGCTGTTCCGCGGCGTCTATTTCACCAGCGGCACCCAGGA
AGGCATGCCATTCGACCGGGTGCTGTCGGCCCTGTCGCGGCGCTTTTCGGTGTCGCCTCCGGCCAACCTG
GCCGGGGAAGGGCGCGCGGGCAAGAGCTACTTCATCGAGACCCTGCTCAAGGGGGTCATCTTCAACGAGG
CCGGGCTGACGGGGCGCAATGCCAAGAAGGAACGACAGCTCCGGCTACTGCAGGCCGCCGGCTTCTTCGC
CCTCGCTGCAGGGCTGGCGGGCGCCACCATCGCCTGGACGATCAGCCACGGCAACAACCAGAAGTACCTG
GACGAGGTGGCCGCGAAGGTGCCCACGCTCAAGCAGGCCGTGGAGGAGTCGCGCGACGCGGACCCGGAGA
ACATGGTGGCACTGCTGCCGTTGCTCAACCATGCCGAATCCCTGGCGACGAGCCAGCGCTACACCGGCGA
CTCGCCGCCGCTCAGCTGGCGCTACGGGCTGCTGCAGGTGCCCAAGGTGCAGACCGCGGCCGATGCGACC
TACATGCGCCTGCTGGAGGATGCCTGGCTGCCCCGCCTGGCCCGGCACCTGCGCAATTCGCTGCAGCAGG
CTTCGACGGCCAATCCCGAGGCCAGCTACGAAGCGCTCAAGGTCTACCTGATGCTCTACGATCCGGAGCG
CTTCAACCCCCGCGTGGTCAAGGCCTGGATGCTCAACGAGTGGGAATCCACGCTGCCTCCGGCGCTGGTG
CAGTCGGGCATGCTGGACCAGTTGGCCCACCACCTCGACCGGCTCATGGAAGACCGCGCCCTGGTGTCGC
CGATCCCGATCGACCAGCCGCTGGTGGACGAGGTGCGCCAGCGGCTGGCGCAGCTGTCGCCCGCGCAGCG
GGCGTACAGCCGGCTCAAGCAGCTGCTGACCACGGGCACCGCGCTACCGCCGGATTTCACGCTGGTGCGC
GCGGCCGGCCCCGAGGCCCCGCAGGTCTTCACCCGGCGCAGCGGCAAGCCGCTCACGCAGGGGATCTCGG
GTCTCTTCACCTATGACGGCTACTACGGTGTTTTCTCGCACGAACTGCCGAAGGTGACCGCGCTGCTGGC
GCAGGAGGAGACCTGGGTCCTGGGCAAGGCGCAGGGGCAGCGCAGCGTGGCCAACGAGGTCATGACCGGC
CAGCTCGCGCTGGAGGTCAAGCGCCTCTACCTCATGGAATATGCCAAGGTCTGGGAGGACTTCCTCGCCG
ATGTGCGGCCTGTGCAGATGGCGTCGCTCGACCAGGCCGGCGAGCAGGCGCGGCTGTATTCGTCTGCCAA
TTCCAGCCTGGAGCAGTTCATCCGTGCCGTGGCCAAGGAAACCACGCTGGGGCAGAAGCCCGGTGCGGGG
GGCAGCAGCACCAGCAGCTGGCTGGGCGAGAAGATCAACCGCATCAAGGAGGAGCAGGAGCAGCTCAGCC
GCCTGACCGGCAAGCGGGTGAACGTCGGCGGGCTCGCGGCCACCAGCAGCAACCTGGAAGCCGACCTGGT
GGATTTCCGTTTCCGCGAATACCGCCGCCTCGCCGCCTCCAATGGATCGGGCCCCGCGCCCATCACCGCC
AGCCTGCAGGTGCTCAACGAAGCGGCTGCGGTCATTTCGTCCGCGCGCCAGCAGATCAGTGCCGGCGGCA
CCGTGCCCGCATCGCTGTCGCCGGCCCTGGAGCGCGTGCGCATGGAGGCCAAGCGCGTGCCGCCGCCGCT
CAACACCATGTACGAGGACCTGGCATCGTCCACGTCGGCGCTGGTCGGCCGCGATGTGCGCGCGACCGTG
GGCAGCAACCTCAATGCCACCATCGGTACGTTCTGCCGCCGCGCGATCGGCGGGCGCTATCCCTTCACCA
AGGGATCGTCCAGCGACGTGACGAGCGATGACTTCGCCAGCCTGTTCTCGCCGGGCGGCATGATGGACGA
GTTCTTCCGCAACACCCTGCAGCCGATGGTGGACATCTCCGCCACGCCCTGGCGCTTCCGCCAGGGCGTC
GATGGAACGCCGGTCGGCGGGTCGGCCGCGCTGGCGTCGTTCCAGCGCGCCGCGACCATCCGCGACGTGT
ATTTCCGGGCGGGCGGCAAGGTCCCGTCCATCCGCATGGACATCAAGCCCCTGGAGATGGACGCCTCCAT
TTCCCAGATGGTGCTGGACATCGACGGCGAGGTGCTGCGCTACCAGCACGGCCCGCAGATCCCGAAGTCG
ATGACCTGGCCCGGTACCCGGGGCACGGGGCAGGTCCGCCTGCAGCTCACCGGGGGCGGAGCCGAGAACA
CCGGCCTGGTGACCGAGGGGCCCTGGGCCGTGCATCGTTTCTTCGACAAGGCCCAGATCCTGCCGGGCAG
CACGCCCGAGCGCTTCGTCGCCGCGTTCGACATCGGCGGGCGCAAGCTGCGCTTCGAGGTCACCACGGGC
AGTGTGCTCAACCCGTTCCGTCTCAAGGCCATGGAGGAATTCGCGTGTCCTGGCAATCTCTGA
 Primer design