SecReT6
Protein ID: 326404481
SecReT6 ID425
T6SS typeN/A
Gene symbol-
Locus tagACMV_23340
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T6SS(s) in this replicon]
Location [Strand]2579930..2583457 [-]
Producthypothetical protein
NoteTssM
UniProt IDF0J1D8
KEGG IDamv:ACMV_23340
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.70E-88, Aligned region: 181..440
IcmF-related [PF06761], Evalue: 6.80E-81, Aligned region: 495..794
IcmF-related [PF06761], Evalue: 6.80E-81, Aligned region: 860..886
DUF1215 [PF06744], Evalue: 1.00E-25, Aligned region: 911..1034
AAA_19 [PF13245], Evalue: 0.0033, Aligned region: 114..134
AAA_25 [PF13481], Evalue: 0.0089, Aligned region: 108..137
Protein Sequence: 1175 a.a.     [Download]
>gi|326404481|ref|YP_004284563.1| hypothetical protein ACMV_23340 [Acidiphilium multivorum AIU301]
MSARLVRWLLSGVGAAIIAALVWFFGPFLAVLAGILPRAAIAVLVFVIWLAANLWLDRRARKKAAAVEEA
ITETQADPEAGMRAEEVAALADKMKKALGILARARGRRGFLYEQPWYVIIGPPGAGKTTALLNAGLNFPL
AAELGQGAVAGVGGTRYCDWWFTDQAVMIDTAGRYTTQDSSASVDQAGWHGFLDLLRRTRPRQPLNGVIV
AIALSDIAQADAAARAAHARAIRARIKEINTRLGVTVPVYALFTKADLIAGFTEFHDDLDTAGRAQVWGM
TFPPDRTPAGMAGRFAAEFRELVGRVEERMLDRLAAERSPDRRSLIAGFPMQVASLQAPLEAFLNEAFAG
SQLDPAPWLRGVYLCSGTQEGTPIDRLTGALARSFGIDQRRAPSLRPQSGRSYFLGRLIGEVIFGEAMLG
SADRSGARRRLALRGAGFGAVGLVFVVLLAALFRSHADNAAAIARARAGLAAEQKVAAQIRLDPVASADL
SRIAPLLREARDLAGAPPERGYHGIGLDQGASIRAATAAVYRNVLDHALLPRLVLQLEAEMRGGLDRPDF
LYQATRVYLMLGNQGPLDASLVEAWMKLDWRRLYPGFGQTALRHSLMRDLTALLARPLPDVPLDGQLIAT
ARATFSRVPIAERVYSRIRDSEAASRVPAWTPAAALGAAGTPYFVNATGKPLTDGVPGFFTKRGFYTVLL
PALTHATQDVARESWVLGAQDRIKPDSPQMQSLEQDVIRLYDTAYARHWQSMIDDLNIAPLGSAGQAVQA
LYVLGSPQSPMVRLLSSMADELTLTKPPKDLAKAAKGATGAEAKLRAPAKLNEAATRLKQLLGPQASGAP
APKPGAAINAEFAPLRNYVGTGAAGSPLSLTLQLIDQVQKQLATLAATAPGAAGPASPAAGGDAAQLLAG
EAQHDPQPVSRWLGAIVATSNSLRGGSAAAAAAAAFKAPGGAAALCEKAVTGHYPFDASAASGIPLADFA
RLFAPGGVMDNFFNTQVRPFVNMTGQVWTVQPVNGVAPPVSQGAVAEFQRAQEIQQMFFLGGTQPSVQFT
VTPAGLSAGAAQVVLQLGGVDVSYAHGPTVPTSVNWPGATGMQTARLIITPAAGGTPVTLQASGPWAVFR
LFGMGRLTRDGSSARYTLTFDQGGMQARFTLEAGSIFNPFAPGVLNDFRCPSLKG
 
Nucleotide Sequence: 3528 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c2583457-2579930 Acidiphilium multivorum AIU301, complete genome
ATGAGCGCACGGCTGGTCCGCTGGCTGCTGAGCGGCGTCGGCGCCGCGATCATCGCGGCCCTGGTCTGGT
TCTTCGGCCCCTTCCTCGCCGTGCTCGCCGGCATCCTGCCGCGCGCGGCGATCGCTGTCCTGGTGTTCGT
GATCTGGCTTGCGGCCAATCTCTGGCTCGATCGCCGCGCCCGCAAGAAGGCGGCCGCCGTCGAAGAGGCG
ATCACCGAGACCCAGGCCGACCCCGAGGCCGGCATGCGGGCGGAGGAAGTCGCCGCGCTGGCGGACAAGA
TGAAGAAGGCGCTTGGCATCCTCGCCCGGGCGCGCGGCCGGCGCGGCTTTCTCTACGAACAGCCCTGGTA
CGTCATCATCGGCCCGCCCGGCGCCGGCAAGACCACCGCGCTGCTCAATGCCGGGCTGAACTTTCCGCTC
GCCGCCGAGCTCGGCCAGGGGGCGGTCGCCGGTGTCGGCGGCACCCGCTATTGCGACTGGTGGTTCACCG
ACCAGGCGGTGATGATCGACACCGCCGGCCGCTACACGACGCAGGATTCCTCGGCGTCGGTCGACCAGGC
CGGCTGGCACGGCTTCCTCGACCTGCTGCGCCGCACCCGGCCGCGCCAGCCGCTGAACGGCGTGATCGTC
GCCATCGCCCTGTCCGACATCGCCCAGGCCGACGCCGCGGCCCGCGCCGCCCATGCGCGCGCCATCCGCG
CGCGGATCAAGGAGATCAACACCCGCCTCGGCGTCACCGTGCCGGTCTACGCGCTGTTCACAAAGGCCGA
CCTGATCGCCGGCTTCACCGAGTTCCATGACGATCTCGACACCGCCGGCCGCGCGCAGGTCTGGGGCATG
ACCTTTCCGCCCGATCGCACGCCGGCGGGCATGGCGGGCCGGTTCGCCGCCGAGTTCCGCGAGCTGGTCG
GCCGCGTGGAAGAGCGCATGCTCGACCGCCTCGCCGCCGAACGCAGCCCGGATCGCCGCTCGCTCATCGC
CGGCTTCCCGATGCAGGTCGCGAGCCTGCAGGCGCCGCTGGAGGCCTTCCTGAACGAGGCGTTCGCCGGC
TCCCAGCTCGATCCCGCGCCGTGGCTGCGCGGGGTCTATCTCTGCTCGGGCACGCAGGAAGGCACGCCGA
TCGACCGTCTGACCGGCGCGCTGGCCCGCAGCTTCGGCATCGACCAGCGGCGCGCGCCCAGCCTGCGGCC
GCAATCCGGCCGCTCCTATTTCCTCGGCCGGCTGATCGGCGAGGTGATCTTCGGCGAGGCCATGCTGGGC
TCGGCGGACCGGTCCGGCGCCCGGCGCCGCCTCGCGCTGCGCGGCGCGGGGTTCGGCGCGGTCGGCCTCG
TGTTCGTCGTGCTGCTCGCGGCGCTGTTCCGCAGCCATGCCGACAATGCCGCCGCCATCGCCCGCGCGCG
CGCCGGGCTTGCCGCCGAACAGAAGGTCGCGGCGCAGATCCGGCTCGATCCGGTCGCCAGCGCCGATCTG
TCGCGGATCGCGCCGCTGCTGCGCGAGGCCCGCGACCTTGCCGGCGCGCCCCCCGAGCGCGGCTATCACG
GCATCGGCCTCGACCAGGGCGCCTCGATCAGGGCTGCGACAGCCGCCGTCTACCGCAACGTGCTCGACCA
CGCGCTGCTGCCGCGCCTCGTGCTTCAGCTCGAGGCGGAAATGCGCGGCGGGCTCGACCGGCCGGATTTC
CTGTATCAGGCGACCCGCGTCTATCTCATGCTCGGCAATCAGGGACCGCTCGACGCCTCGCTGGTCGAGG
CCTGGATGAAGCTCGACTGGCGGCGCCTCTATCCGGGCTTCGGCCAGACCGCATTGCGCCATTCGCTGAT
GCGGGACCTGACCGCGCTGCTCGCCCGCCCGCTGCCGGACGTTCCGCTGGACGGCCAGCTGATCGCCACC
GCGCGCGCGACCTTCTCGCGCGTGCCGATCGCCGAGCGGGTCTATTCCCGCATCCGCGATTCCGAGGCGG
CGTCCCGCGTGCCGGCCTGGACGCCGGCGGCGGCGCTGGGGGCTGCCGGAACGCCCTATTTCGTCAACGC
CACCGGCAAGCCGCTGACCGATGGCGTGCCCGGCTTCTTCACCAAGCGCGGCTTCTACACCGTGCTGCTG
CCGGCCCTCACCCATGCGACACAGGATGTCGCCAGGGAAAGCTGGGTGCTCGGCGCGCAGGACCGGATCA
AGCCGGATTCGCCGCAGATGCAGTCGCTCGAGCAGGATGTGATCCGGCTCTACGACACCGCCTATGCCCG
GCACTGGCAGTCGATGATCGACGACCTCAATATCGCGCCCCTCGGCTCCGCGGGCCAGGCCGTGCAGGCG
CTCTACGTGCTTGGCTCGCCCCAATCGCCGATGGTGCGGCTGCTGTCGTCGATGGCGGACGAGCTTACGC
TCACCAAACCGCCGAAAGACCTTGCGAAGGCCGCCAAGGGGGCGACGGGCGCCGAGGCGAAGCTGCGGGC
ACCGGCCAAGCTGAACGAAGCGGCGACGCGGCTGAAGCAGTTGCTGGGCCCGCAGGCGTCAGGCGCCCCG
GCCCCGAAGCCCGGGGCGGCAATCAACGCCGAGTTCGCGCCGCTGCGCAATTATGTGGGCACCGGCGCGG
CAGGCTCTCCGCTCTCGCTGACATTGCAACTGATCGACCAGGTGCAGAAGCAGCTGGCAACCCTCGCCGC
CACGGCGCCCGGCGCGGCGGGCCCCGCGTCCCCCGCCGCCGGCGGCGATGCGGCCCAGCTCCTTGCCGGC
GAGGCACAGCACGATCCGCAGCCGGTCAGCCGCTGGCTCGGCGCGATCGTCGCGACATCGAACAGCCTGC
GCGGCGGCAGCGCCGCGGCGGCGGCGGCGGCGGCGTTCAAGGCGCCGGGCGGTGCCGCGGCACTCTGCGA
GAAGGCGGTGACCGGCCATTACCCGTTCGATGCAAGTGCCGCCTCGGGCATTCCGCTTGCCGATTTCGCC
CGGCTCTTCGCGCCGGGCGGCGTGATGGACAATTTCTTCAACACGCAGGTGCGGCCCTTCGTGAACATGA
CCGGGCAGGTATGGACGGTGCAGCCGGTGAACGGCGTGGCGCCGCCGGTCAGCCAGGGGGCCGTCGCGGA
ATTCCAGCGCGCGCAGGAAATCCAGCAGATGTTCTTCCTGGGCGGCACGCAGCCCAGCGTGCAGTTCACG
GTCACGCCCGCCGGCCTCTCGGCGGGCGCGGCACAGGTCGTGCTGCAGCTTGGCGGCGTCGATGTCAGCT
ACGCCCACGGCCCGACGGTGCCGACCTCGGTGAACTGGCCGGGTGCCACCGGCATGCAGACGGCCCGGCT
GATCATCACGCCGGCCGCCGGCGGCACGCCGGTCACGCTTCAGGCCAGCGGTCCCTGGGCGGTGTTTCGC
CTGTTCGGCATGGGGCGGCTCACGCGTGACGGCAGCTCCGCCCGCTACACCCTCACCTTCGATCAGGGGG
GCATGCAGGCGCGCTTCACGCTCGAGGCGGGGTCGATCTTCAACCCGTTCGCGCCGGGCGTGCTGAACGA
CTTCCGCTGCCCGAGCCTCAAAGGATGA
 Primer design