SecReT6
Protein ID: 326424232
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0428
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]460550..462385 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ8D6U7
KEGG IDvvu:VV2_0428
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-57, Aligned region: 30..333
Phage_base_V [PF04717], Evalue: 2.90E-26, Aligned region: 377..469
Protein Sequence: 611 a.a.     [Download]
>gi|326424232|ref|NP_762392.2| hypothetical protein VV2_0428 [Vibrio vulnificus CMCP6]
MKKATQDNKFINISTPYGKDAIILNSFEYREEMSELFSLRVYAYFNGRKGELNQIVGQPVIIKMDNNSQV
MLEPRYFHGFVAKATLAGSRVTKFEDGENYKNIELVVVPKLNFADYKINSRIFQNKDIKEIISLILGEHG
VDFSFSLTKSYAKYNYKVQYEESDLQFVKRLLSEEGLSFCFSHTKSSHVIEIFDDASYYKPGAEFLIDFN
SGTAELGHISSWHEAQSMVITRSHKSGYDMKKPASHPNNTAKGSESLFTVPSSEHYEYLGEAESGDQYKT
RNTHTIESLQQNAYVCSGESSCRSFAVGRSFKFGKHEDPSRIGKEFVLSSIVINAAVFNQVGHGGPSNQG
VRSYFTCIESGKVHRPAVNFVRPVIRGIQTAVVTGNKQGEIYVDKYGRIKVQFHWDREGKFDTTSSCWIR
VAQQIAGNGWGSSFLPRVGQEVIVEFINGDPDQPVVTGSLYNGTQAPPFSLPEKKTQSGYRSQSVEKGAS
NFNELRFEDKPGEEHVYLHAEKNFQMVVEDSADVLVENNKTQKITNNLTEEVGQNVSGKIGKNYSLDIGE
VLSLTAGKSIEIKVGGASIQMSSSGEINIKGNKIAINGASIALKAGQISLN
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c462385-460550 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGAAAAAAGCGACTCAAGATAATAAATTTATAAATATTTCCACGCCTTATGGGAAAGATGCGATTATTC
TCAATTCCTTTGAATATAGAGAAGAAATGTCAGAGCTATTTTCATTGCGAGTTTATGCTTATTTTAATGG
TCGAAAAGGCGAACTGAATCAAATCGTGGGTCAGCCAGTTATTATCAAAATGGATAATAATAGCCAAGTC
ATGTTGGAACCGAGATACTTCCATGGGTTTGTTGCAAAGGCAACACTAGCAGGAAGCCGAGTGACCAAAT
TTGAAGATGGTGAAAACTACAAAAACATTGAGCTTGTTGTTGTGCCAAAATTGAATTTTGCGGACTACAA
AATCAACAGCCGAATCTTTCAAAATAAAGATATAAAAGAAATCATTTCATTAATTCTTGGTGAGCATGGC
GTCGACTTTTCTTTTTCTCTGACCAAAAGCTATGCCAAGTATAACTACAAAGTTCAGTACGAAGAATCGG
ATCTACAGTTTGTTAAAAGACTCTTATCTGAGGAAGGGCTGTCGTTCTGTTTCAGCCATACTAAATCTTC
ACATGTGATCGAGATATTTGATGATGCCAGCTATTACAAGCCAGGTGCTGAATTTTTAATTGATTTCAAT
TCAGGTACCGCAGAGTTGGGTCATATCTCTTCGTGGCATGAAGCTCAATCGATGGTGATCACGCGCAGTC
ACAAAAGTGGCTATGATATGAAAAAGCCAGCTTCACATCCTAACAATACGGCAAAAGGGAGCGAATCCTT
ATTTACCGTTCCGAGCAGCGAGCATTATGAATATCTGGGTGAAGCGGAGTCGGGTGATCAGTACAAAACG
AGAAATACCCACACGATCGAATCATTACAGCAAAACGCATACGTTTGTTCTGGAGAGTCGAGTTGCCGCT
CCTTTGCGGTCGGCAGAAGTTTCAAATTTGGTAAGCATGAAGACCCTAGCCGAATCGGCAAAGAGTTCGT
GCTCTCATCGATTGTTATCAACGCAGCTGTTTTCAACCAAGTAGGTCATGGTGGCCCTTCAAATCAAGGT
GTTAGGAGTTATTTTACCTGCATTGAGTCAGGGAAAGTGCATCGTCCGGCGGTTAACTTTGTGAGGCCAG
TTATTCGCGGAATCCAAACTGCGGTTGTGACAGGTAATAAGCAAGGTGAAATCTACGTCGACAAATATGG
GCGGATAAAAGTTCAATTTCACTGGGATCGTGAAGGTAAGTTTGATACGACGAGTTCGTGCTGGATACGT
GTCGCACAACAAATTGCAGGGAATGGCTGGGGAAGCTCATTTCTGCCAAGAGTAGGGCAAGAGGTCATCG
TTGAATTTATCAATGGGGATCCGGATCAGCCAGTGGTGACAGGGTCTCTTTACAATGGGACGCAAGCGCC
ACCTTTTTCGTTGCCAGAGAAGAAAACCCAAAGTGGTTACCGTAGCCAGTCTGTAGAAAAAGGGGCGAGT
AACTTCAACGAGTTACGCTTTGAAGATAAACCGGGTGAGGAACATGTCTATCTTCATGCGGAAAAGAACT
TCCAAATGGTCGTCGAAGATTCCGCTGATGTCCTAGTTGAAAACAATAAGACCCAGAAAATTACCAACAA
CCTAACGGAGGAGGTTGGACAAAACGTCTCTGGGAAGATTGGGAAAAACTATTCACTCGATATTGGCGAA
GTCCTTTCTCTGACCGCAGGCAAAAGCATTGAAATTAAAGTGGGCGGCGCTTCGATTCAGATGTCGAGTT
CGGGGGAGATCAATATTAAAGGCAACAAAATAGCCATTAATGGTGCCTCGATTGCCTTAAAAGCTGGCCA
GATTTCACTGAACTAG
 Primer design