SecReT6
Protein ID: 326424233
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0441
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]475972..479496 [-]
ProductIcmF-like protein
NoteTssM
UniProt IDQ8D6T4
KEGG IDvvu:VV2_0441
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-89, Aligned region: 60..112
ImcF-related_N [PF14331], Evalue: 3.50E-89, Aligned region: 191..454
ImcF-related_N [PF14331], Evalue: 3.50E-89, Aligned region: 1028..1057
IcmF-related [PF06761], Evalue: 1.40E-81, Aligned region: 504..806
DUF1215 [PF06744], Evalue: 3.30E-36, Aligned region: 920..1036
Protein Sequence: 1174 a.a.     [Download]
>gi|326424233|ref|NP_762405.2| IcmF-like protein [Vibrio vulnificus CMCP6]
MQTMAKIKRLLGQKWLISLIGLGAISIFIWFVGPLIAIAGIEPLKSDFNRLLVIVVLVFIWGVTNVVRQQ
KERKEQDESIQSLLEVDALTDKEAAAEIDVMRERIEKAIQVVTKGGKRKSHLYQLPWYVLIGPPGTGKTT
ALKESGLEFPLSDSMGVDSVSGIGGTRNCDWWFTNKAVLIDTAGRYTTQDSQAHVDSKAWYGFLGLLKQY
RKQRPINGAIVTVSIASMLTQTRTERGMHARAIKNRLQELKNQLGMQFPIYVVLTKADLIAGFSEFFTEL
TKEEREQLLGFMFPPSVEDERGVISLFNKEFHDLLERLDRRMMQRLETEHDLDKRSLIFEFPKQLRCLQA
NLDEFLNDIFAQNKFEESSMIRGVFIVSSLQEGTPVDRIMSETSQGLGLGKPLLRLSSKESSSYFVKNLF
ENVIFKEQFLGTVNRHHQKQSGWIRKGVYCSCLALSGAAITLWMMSYQWNNQLIDETDRQVAVVNDLLAK
SGLDFENDLIPSINILNHIMRFPMGYRQQDDERDRVTSFGLFQGEKIGQSAKSAYHQALTNYYSSYVESV
LLSEMKNNEQHREYLYETLKTYLMLFNDDKFEREHVLGWFNYFFERQYPGELNEELREQLYAHTENFLSQ
ADRGLYINNDSVTAARLVLTEMSLSERAYQRMKLQFLKSHVPSFRLTDVLGARGVEQFERKSGKPLSMGI
SGFYTYNGFHSIFQLQLGRMVKALMEENWVYGDEIDAQNIDHDLALQGVRERYYRDYVYEWKTLLNDIQL
KAAPSLKLSLEQSMALAGSERPIESLLKAVQKEVALTKISLSNNEKAVAEVAGKVAKVKFSNTADKLDLY
RPEEGNTFDIALPGKEVEAEFDDLVRMTDQDFDDIHLALSGLKSYLADLSSSGNNQKVAYKSILNGTVTG
EVAASIEHAKQLLPAPFNNWLGELSEESVKLAEKGSRSHLNTLWVNKVLKPYERSIKGRYPFEPRAKTEV
TLKDFSRFFGYGGTLDAFFVEYLEPFVDTSRSVWRFEKEIGVSQETLAVFQRADRIRQSFFELDNTLKVD
FAMKPIYLDQHITSFVLEVGGQNLAYRHGPARVKNLSWPAKRSATRVVFTPPDSIREIAYTYEGEWGIFK
LLDQSLKARPQSRKDNIVMIDLKGNKVQLELIPKSTMNPFWSSDMESFRCPQTL
 
Nucleotide Sequence: 3525 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c479496-475972 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGCAAACAATGGCAAAGATTAAACGTTTATTGGGGCAAAAATGGCTGATTAGCTTGATCGGGCTTGGGG
CAATTTCTATTTTTATTTGGTTTGTCGGACCATTGATCGCGATAGCAGGCATAGAGCCACTGAAATCAGA
CTTTAACCGTTTGTTGGTTATTGTGGTTTTAGTCTTCATTTGGGGCGTAACGAATGTTGTCCGTCAACAG
AAGGAGCGAAAGGAACAAGATGAAAGCATCCAAAGCCTATTAGAGGTGGATGCCCTGACCGATAAAGAAG
CGGCGGCAGAAATAGACGTCATGCGCGAAAGAATTGAGAAGGCGATTCAAGTCGTGACGAAAGGTGGAAA
GCGTAAGAGTCATCTCTACCAGTTGCCTTGGTATGTACTTATTGGTCCTCCTGGAACAGGTAAAACGACG
GCATTAAAAGAATCGGGTCTCGAGTTTCCTCTATCAGATTCAATGGGTGTTGACTCGGTTTCTGGTATTG
GCGGTACGAGAAATTGTGATTGGTGGTTTACCAATAAAGCGGTGTTGATTGATACGGCTGGCCGGTACAC
CACGCAAGATAGCCAAGCTCATGTCGATTCAAAAGCATGGTATGGATTCTTAGGCTTATTAAAGCAATAC
CGTAAACAGCGTCCCATTAATGGTGCGATTGTTACCGTCAGCATCGCCAGTATGCTAACACAAACTCGCA
CCGAACGAGGCATGCATGCAAGAGCGATAAAAAATCGGCTACAAGAACTGAAAAATCAATTGGGTATGCA
GTTCCCAATCTACGTTGTGTTGACGAAGGCTGATCTCATTGCGGGTTTTAGTGAGTTTTTTACGGAACTG
ACCAAGGAAGAGCGAGAGCAGTTATTAGGATTTATGTTTCCGCCCTCAGTAGAAGACGAACGAGGTGTCA
TCTCTCTATTTAACAAAGAGTTTCATGATTTACTGGAGAGACTTGATCGCCGCATGATGCAAAGGCTTGA
AACGGAACATGACCTTGACAAGCGATCTTTAATTTTTGAATTTCCAAAGCAATTGCGTTGTCTTCAAGCG
AATCTAGACGAGTTTCTTAACGACATTTTTGCCCAAAACAAGTTTGAAGAATCTTCAATGATTCGCGGCG
TCTTTATTGTGAGTTCGTTGCAAGAAGGCACGCCGGTTGATCGTATCATGTCTGAAACATCCCAAGGGCT
GGGGTTGGGCAAACCTCTACTGCGGTTAAGTTCCAAAGAATCAAGCAGCTATTTTGTAAAAAACTTGTTT
GAAAATGTTATCTTTAAAGAACAGTTTTTAGGGACGGTCAATCGTCATCATCAAAAGCAAAGTGGTTGGA
TCCGAAAAGGCGTCTACTGCTCGTGCCTAGCGCTGTCTGGGGCTGCCATCACTCTGTGGATGATGAGTTA
TCAGTGGAACAATCAACTCATTGATGAAACGGATCGTCAAGTAGCTGTGGTGAATGACTTACTTGCTAAG
TCTGGTCTGGACTTCGAAAACGACTTGATCCCCTCGATAAACATTCTCAATCACATCATGCGTTTCCCTA
TGGGTTATAGACAGCAAGATGACGAGAGAGATCGTGTGACATCGTTTGGTTTGTTTCAAGGTGAAAAAAT
TGGCCAATCGGCTAAGAGTGCTTATCACCAAGCATTGACAAATTACTATTCATCTTATGTTGAATCGGTA
CTTCTCAGTGAAATGAAGAACAATGAACAGCACCGAGAATATCTGTACGAAACACTCAAAACATATTTGA
TGCTCTTCAACGATGACAAATTTGAGCGTGAACATGTTCTTGGTTGGTTCAATTATTTCTTTGAAAGGCA
GTATCCCGGTGAACTGAATGAAGAGTTAAGAGAGCAACTCTACGCTCATACCGAGAACTTTTTGTCGCAG
GCAGACAGAGGCTTATATATCAACAACGATTCAGTAACCGCTGCCAGATTGGTTCTAACAGAAATGTCGT
TGTCGGAAAGAGCCTACCAAAGAATGAAACTGCAGTTCCTTAAAAGTCATGTGCCTTCATTTCGTTTAAC
GGACGTTCTAGGGGCTAGGGGAGTTGAGCAGTTTGAGCGAAAAAGTGGCAAGCCATTATCGATGGGGATT
TCCGGTTTCTACACGTACAACGGTTTCCATAGCATCTTCCAATTGCAACTGGGTCGTATGGTAAAAGCCT
TGATGGAAGAAAACTGGGTGTATGGGGATGAGATCGACGCCCAAAACATCGACCATGATCTCGCTTTGCA
AGGTGTGAGAGAGCGCTACTATCGTGACTATGTCTATGAATGGAAGACACTGCTCAATGACATCCAACTC
AAAGCGGCACCAAGTTTGAAACTAAGTTTAGAGCAGAGTATGGCATTAGCGGGCTCTGAGCGACCAATTG
AATCGCTGCTTAAAGCGGTACAAAAAGAGGTGGCATTAACGAAAATTTCGCTAAGCAACAACGAAAAAGC
GGTAGCTGAAGTCGCTGGCAAAGTTGCCAAAGTGAAATTTTCAAATACGGCGGACAAACTTGATTTATAT
CGTCCGGAAGAGGGCAATACGTTTGATATTGCGCTTCCTGGAAAAGAAGTGGAAGCCGAGTTTGACGATC
TTGTTAGGATGACAGACCAAGACTTTGACGATATTCATCTCGCACTGAGTGGTTTAAAAAGTTATTTGGC
CGATCTCTCTAGCTCAGGAAATAATCAGAAAGTCGCCTACAAGAGCATCTTAAATGGCACCGTGACAGGA
GAAGTTGCCGCGTCAATTGAACATGCTAAACAGCTTTTACCCGCTCCGTTCAACAACTGGCTAGGTGAAC
TTTCCGAGGAATCGGTCAAGTTAGCGGAAAAAGGATCGCGATCTCACCTTAATACGCTATGGGTTAACAA
GGTTCTTAAACCTTATGAGCGCAGCATCAAAGGCAGGTATCCGTTTGAGCCAAGAGCGAAAACAGAAGTG
ACGTTAAAGGACTTCAGTCGATTCTTTGGCTACGGCGGAACACTTGATGCGTTCTTTGTCGAATACTTGG
AACCGTTTGTCGATACGTCGAGAAGTGTGTGGCGCTTCGAGAAGGAAATCGGTGTCAGTCAAGAAACACT
CGCCGTATTTCAACGCGCAGATCGCATCCGACAATCGTTTTTCGAACTCGACAATACATTAAAAGTCGAT
TTTGCAATGAAACCGATATACCTCGACCAACATATAACCAGCTTTGTACTGGAAGTTGGGGGGCAGAATC
TTGCATATCGACATGGGCCGGCAAGAGTAAAAAATCTCTCTTGGCCAGCGAAGCGTTCAGCGACAAGAGT
GGTCTTCACACCACCCGATTCGATTCGTGAAATTGCTTATACCTATGAGGGCGAATGGGGCATTTTTAAG
TTGCTTGATCAATCTCTGAAAGCAAGGCCGCAATCTCGCAAAGACAACATCGTCATGATTGATTTGAAAG
GCAACAAAGTTCAACTGGAATTGATTCCTAAGAGTACGATGAACCCATTTTGGTCGAGTGATATGGAGAG
TTTCCGATGTCCGCAAACGCTATAA
 Primer design