SecReT6
Protein ID: 326424234
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0443
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]480811..482133 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ8D6T2
KEGG IDvvu:VV2_0443
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.90E-140, Aligned region: 19..438
Protein Sequence: 440 a.a.     [Download]
>gi|326424234|ref|NP_762407.2| hypothetical protein VV2_0443 [Vibrio vulnificus CMCP6]
MSVYSPIVWSEGMFLRPQHFQQQERALSHEYKGLTRLVGCYARGIESFSLDKEQLKEGVVSLTECVGIFS
DMTFVNIPINEQLPEPLKIEPGIENTLVQLVIPAEKSQGQNVSHSETSMVTRYKVVDHTLTDSVSGDEEV
LQLAALKCELKATNDNLPGYVSLPLVKIRHVGSEGQVILDEEFVPPFLNVHHSSLLTRYLNNVLAMIKIR
ADAIASRLGQGKSASSSAVDFIMLQMLNRYEANLRHLSKGSELHPHELATALLSLIGELSTFSSKNKRVP
KLPEYQHSNLGPVFSEMNQILSQYLSVVLEQTATKMPLDIRQFGIRVTPLPDKSLLSLCQFVLAVKADVS
ADEIRKKLPGQIKVGPAENIRDLINNQINGIAVSPLNVVPRQMPYAAGYVYFELVKQGAYWARLNESGGM
AFHVSGNYPGLEMELWSINQ
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c482133-480811 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGAGTGTTTATTCACCGATTGTTTGGAGTGAAGGGATGTTTCTGCGTCCTCAACACTTTCAGCAACAAG
AGCGAGCGTTGTCTCATGAATACAAAGGTCTAACGCGTTTAGTGGGTTGTTATGCCCGAGGAATTGAATC
GTTTTCTCTCGACAAAGAACAGTTGAAAGAAGGGGTTGTATCGCTAACTGAGTGTGTTGGAATTTTCTCC
GATATGACATTCGTTAACATACCTATTAACGAGCAGCTTCCTGAGCCACTCAAAATTGAGCCAGGGATTG
AAAATACTTTGGTTCAGCTTGTGATACCTGCAGAAAAATCCCAAGGCCAAAACGTTTCCCATTCCGAGAC
TTCAATGGTAACGCGCTATAAGGTGGTTGATCACACCTTAACCGATAGCGTGTCTGGTGATGAAGAAGTA
CTTCAACTCGCGGCGCTTAAGTGCGAGTTAAAGGCAACCAATGACAATTTGCCGGGCTATGTCTCTTTGC
CTCTGGTGAAAATTCGTCATGTTGGTAGCGAAGGTCAAGTCATTCTTGATGAAGAGTTCGTACCACCTTT
CCTTAATGTCCACCATAGTTCGCTGCTTACTCGTTATCTGAATAACGTTTTAGCCATGATCAAAATTAGG
GCAGACGCCATTGCAAGTCGTCTCGGACAAGGCAAGTCAGCGTCTTCCTCTGCAGTAGATTTCATTATGC
TACAGATGCTGAATCGTTATGAGGCTAATTTAAGACATTTATCGAAAGGGAGTGAGCTTCATCCACATGA
GTTAGCGACGGCCTTATTGAGCTTAATTGGTGAGCTGTCCACTTTTTCGAGTAAAAATAAGCGAGTCCCT
AAGCTTCCCGAATACCAACACAGTAATTTGGGGCCTGTCTTTTCTGAGATGAATCAAATCCTCAGTCAAT
ATCTGAGTGTGGTATTGGAGCAAACTGCGACCAAGATGCCCTTGGATATTCGCCAGTTTGGGATTCGCGT
TACGCCATTACCAGATAAAAGTTTGCTTTCACTTTGTCAGTTTGTATTGGCCGTTAAAGCCGATGTCTCT
GCCGATGAAATTAGAAAAAAGTTACCAGGACAAATCAAAGTTGGACCCGCAGAGAATATTCGCGACCTTA
TCAATAATCAGATCAACGGTATTGCCGTTTCGCCACTGAATGTGGTGCCAAGACAGATGCCTTACGCAGC
AGGCTACGTCTATTTTGAGCTGGTTAAACAAGGCGCTTATTGGGCTCGTTTAAATGAAAGCGGGGGAATG
GCATTTCATGTCTCTGGTAATTACCCAGGGTTAGAAATGGAGCTTTGGAGTATTAACCAATAA
 Primer design