SecReT6
Protein ID: 326424235
SecReT6 ID38
T6SS typei5
Gene symbol-
Locus tagVV2_0445
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T6SS(s) in this replicon]
Location [Strand]482613..483830 [-]
Producthypothetical protein
NoteFha
UniProt IDQ8D6T0
KEGG IDvvu:VV2_0445
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.60E-16, Aligned region: 33..101
FHA [PF00498], Evalue: 2.60E-16, Aligned region: 378..395
Protein Sequence: 405 a.a.     [Download]
>gi|326424235|ref|NP_762409.2| hypothetical protein VV2_0445 [Vibrio vulnificus CMCP6]
MGIVLSITSFHRFTPEIKSVYSIPTNEEHFCMKFGRSESCDWVLPDPERIISGVHGEITKFGNDYLLRDL
STNGIFVNKSVSPVGNGVEVALNDKDVINFGDYEIEVSFKNSENHNVTQSQIHTNTLSPREVNKEPVSGN
DNFMDFGFDANLFLAEEEKQQQNLSPELGDLDDFLDAPILSPHIEPTLKEERATDYPRDEKVAKRCERVD
SDLNAFLKGAGIDLSLVPEQEREQWFNRLGRSYSLMLEGLMQTLHNRAEFKQANKLNHTSFQKKENNPLK
FSANLEDAIHNLYNRRSASFLSPEAAIQSAFNDIEAHEKAMIEGVHGAVSGVLRLLEPNTISGHVSQSEK
NGLTSIFSQLDKKRWKKYENIYFQIRNEIDIDEKGFYLEDFSKSYESAIRKVGRE
 
Nucleotide Sequence: 1218 bp     [Download]
>gi|326424156|ref|NC_004460.2|:c483830-482613 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGGGAATAGTGCTTTCGATTACTAGTTTCCACCGTTTTACACCAGAAATAAAAAGTGTGTATTCAATAC
CCACCAATGAAGAACACTTTTGTATGAAATTTGGTCGCTCTGAGAGCTGTGATTGGGTATTACCTGATCC
TGAACGAATTATTTCTGGTGTTCATGGTGAAATAACTAAGTTTGGTAATGATTATCTACTTAGAGATCTC
TCTACAAATGGTATTTTTGTTAATAAGTCAGTCAGCCCAGTAGGAAATGGTGTCGAGGTGGCTTTAAATG
ACAAAGATGTGATTAATTTTGGAGATTATGAAATCGAAGTATCGTTTAAAAATAGTGAAAACCATAACGT
AACCCAAAGCCAAATCCACACCAATACTCTGTCACCACGTGAAGTAAATAAAGAGCCTGTCAGTGGTAAT
GATAATTTTATGGATTTTGGTTTTGACGCAAACCTATTTTTGGCAGAAGAAGAAAAGCAGCAGCAAAATC
TATCGCCAGAGCTAGGTGATTTGGATGACTTTCTTGACGCTCCCATATTAAGCCCTCACATAGAGCCGAC
TTTGAAAGAAGAGAGAGCGACCGACTATCCTCGTGATGAGAAAGTGGCTAAGCGATGTGAACGTGTTGAC
TCGGATTTGAATGCCTTTCTCAAGGGGGCTGGCATCGATTTAAGCTTAGTTCCAGAACAGGAAAGAGAGC
AATGGTTTAATCGATTAGGTCGCTCTTATTCTCTTATGTTAGAAGGTCTGATGCAGACACTGCATAATCG
TGCGGAATTTAAACAGGCGAACAAATTAAACCATACCTCTTTTCAGAAAAAGGAAAATAACCCTCTTAAG
TTTTCGGCGAATTTAGAAGATGCAATTCACAATCTATATAACAGACGCAGTGCGAGTTTTCTTTCACCGG
AAGCTGCAATTCAATCTGCATTCAATGATATAGAAGCTCATGAAAAAGCAATGATAGAAGGTGTTCATGG
TGCTGTATCTGGGGTGTTACGACTGCTTGAGCCGAATACCATATCTGGACATGTGTCTCAAAGTGAAAAA
AATGGATTGACATCAATATTTTCGCAACTCGATAAAAAACGATGGAAGAAGTATGAAAATATCTATTTTC
AAATAAGAAATGAAATTGACATTGATGAGAAAGGGTTTTATTTGGAAGACTTTTCCAAATCTTATGAATC
GGCAATAAGAAAAGTAGGGAGAGAATAA
 Primer design