SecReT6
Protein ID: 326794066
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0767
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]826039..828102 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDF2K2K5
KEGG IDmme:Marme_0767
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-47, Aligned region: 30..337
Phage_base_V [PF04717], Evalue: 6.20E-25, Aligned region: 368..458
DUF2345 [PF10106], Evalue: 0.00033, Aligned region: 488..599
DUF2345 [PF10106], Evalue: 0.00033, Aligned region: 610..636
Protein Sequence: 687 a.a.     [Download]
>gi|326794066|ref|YP_004311886.1| ImpA family type VI secretion-associated protein [Marinomonas mediterranea MMB-1]
MNELVDPSGSYLVVKNSSSTEFVAANLTIEESLSENYEWVVDVLVTKSAPSDWIGEEVSCDVFSVVGSSR
SSARQFKGYVVKAQAQSQRIDSTYYTIRLTVTPWLFLLKHSRQCRVFQEQTTQTIVTSIFDDLGFKGNYS
VKSMPSTKHEYCVQFNESDFDFITRLLAEEGVHFFFGKDSKADTLYLQDASKPFAKDDLATLDYAAAPTG
DYDVLNKWQREHAFHSASVELTAYDYNQTKLVTSKAKKSKYSVSGNTKLTELFYPTSSKTGAYTDLASSI
ADVQRGQLDSGYHKVLAETESADLCVGHYLKLNAHPSSSEKGNYLVSKIHCEIKENGVSGVQVNSSLICI
PEDQQSYPAMREKPVVHGLQSAVVAGSKDGEPANDASGRVRIKFHWDPETGDKTSCWVRVAQGMAGSSYG
MQFLPRAGQEVLVSFINGDPNQPVVVSSVYNNTKKPPYPTANTTQSGVKTKLVGESNELRFDDKKDNESI
YMHAAKDLTSDVVNDHTETVGGEMSLAVTKNIKQTVEKTHSLTAKEDVSVKTEKNYTLTATEKITEKGKE
ITLEGDSKITLKVGSSEIVMTSSKIEISSGTVEISGSSKVSVDGGSLSQSGTSVSIKSDGSFSAKGGTSM
SLQAGTSLSAKGSTGVTIKGLNCTMQGDVGATVKGNATAEISASGMTTVKGGVVMVN
 
Nucleotide Sequence: 2064 bp     [Download]
>ref|NC_015276.1|:826039-828102 ImpA family type VI secretion-associated protein [Marinomonas mediterranea MMB-1]
ATGAATGAGCTAGTCGACCCAAGTGGCAGCTATCTTGTTGTCAAAAACTCTAGTAGTACCGAATTCGTTG
CGGCTAACCTCACTATTGAAGAGTCCTTGAGTGAAAACTATGAGTGGGTCGTCGATGTGTTGGTTACAAA
GTCTGCCCCATCTGACTGGATAGGTGAAGAAGTCTCCTGTGACGTTTTTAGTGTTGTTGGCAGCAGTCGT
TCTAGTGCACGTCAATTCAAGGGTTATGTCGTTAAAGCTCAAGCCCAATCTCAGCGTATTGATTCTACTT
ATTACACTATTAGGTTAACGGTAACGCCTTGGTTGTTTCTGCTGAAGCATTCTCGCCAATGTCGAGTCTT
TCAAGAGCAAACCACACAAACGATTGTTACGTCTATTTTTGACGACCTTGGGTTTAAAGGGAATTACAGT
GTCAAAAGTATGCCATCAACAAAGCATGAGTATTGTGTTCAATTTAATGAGTCCGACTTTGATTTTATCA
CTCGTTTACTGGCCGAAGAGGGCGTGCATTTTTTCTTTGGTAAGGACAGTAAAGCCGACACACTGTACCT
TCAGGATGCATCCAAACCTTTTGCAAAAGATGACTTAGCGACGCTCGATTACGCTGCTGCGCCTACTGGC
GATTACGATGTTTTAAACAAGTGGCAGAGAGAACATGCTTTTCATAGCGCATCCGTTGAGCTAACAGCCT
ACGATTACAATCAAACAAAGTTAGTCACCAGTAAAGCGAAAAAATCCAAATATTCGGTGTCAGGTAATAC
GAAATTAACGGAACTGTTTTACCCCACGTCCAGTAAAACCGGAGCCTATACTGACCTTGCCTCTTCGATT
GCTGACGTACAGCGAGGACAATTAGACTCAGGTTATCACAAAGTACTTGCTGAAACTGAGTCCGCTGACC
TTTGTGTAGGGCATTACCTAAAACTCAATGCTCACCCGAGTAGCAGTGAAAAAGGAAATTATCTGGTATC
CAAAATACACTGTGAAATTAAAGAGAATGGCGTTTCTGGGGTTCAAGTTAATAGTTCCTTAATCTGTATA
CCGGAAGATCAGCAGAGTTATCCGGCGATGCGGGAAAAACCAGTGGTTCATGGTCTTCAATCTGCAGTTG
TGGCAGGCAGTAAGGATGGAGAACCTGCAAATGATGCGTCCGGTCGAGTAAGAATTAAATTTCATTGGGA
CCCTGAAACGGGTGATAAAACCAGTTGTTGGGTAAGGGTTGCACAAGGGATGGCAGGGAGCAGTTACGGA
ATGCAGTTTCTACCGCGAGCGGGGCAAGAAGTACTTGTTAGCTTTATTAATGGTGATCCCAATCAACCCG
TTGTTGTTTCCAGTGTTTATAACAACACCAAAAAGCCACCATATCCTACTGCTAACACCACTCAGAGCGG
CGTTAAAACGAAATTAGTTGGTGAGTCAAACGAACTTCGGTTTGATGACAAAAAAGACAACGAATCGATT
TATATGCATGCCGCAAAAGACCTCACCAGCGATGTTGTTAACGATCATACCGAAACCGTGGGCGGTGAAA
TGTCGCTAGCGGTGACAAAGAACATCAAGCAGACAGTAGAGAAAACTCACAGTCTCACTGCTAAAGAAGA
TGTCAGTGTAAAAACTGAAAAAAACTACACGTTAACAGCCACCGAAAAAATCACTGAAAAAGGTAAAGAA
ATCACCTTGGAAGGGGACAGTAAAATCACGCTTAAAGTGGGTAGCAGTGAGATTGTGATGACCAGTAGCA
AAATAGAAATTTCGAGTGGAACGGTTGAAATTTCGGGCAGCTCTAAAGTGTCTGTTGATGGAGGTAGTTT
GAGTCAATCAGGCACTTCAGTATCGATTAAATCCGACGGTTCTTTTAGCGCAAAAGGCGGGACTTCTATG
TCTTTACAAGCAGGAACAAGCTTAAGCGCGAAAGGCTCGACAGGCGTCACAATTAAAGGGTTGAACTGTA
CGATGCAAGGCGATGTTGGTGCGACAGTGAAAGGCAATGCAACGGCAGAAATATCGGCAAGTGGAATGAC
GACCGTAAAAGGCGGCGTAGTGATGGTGAACTAG
 Primer design