SecReT6
Protein ID: 326794068
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0769
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]828687..828986 [+]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDF2K2K7
KEGG IDmme:Marme_0769
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 5.30E-19, Aligned region: 4..16
PAAR_motif [PF05488], Evalue: 5.30E-19, Aligned region: 22..89
DUF4150 [PF13665], Evalue: 0.0012, Aligned region: 8..49
DUF4150 [PF13665], Evalue: 0.0012, Aligned region: 59..84
Protein Sequence: 99 a.a.     [Download]
>gi|326794068|ref|YP_004311888.1| PAAR repeat-containing protein [Marinomonas mediterranea MMB-1]
MPCAARLTDMHTCPMQTPAVPPIPHVGGPIVSPGAPTVLICKLPAAKMGDMCVCVGPPDSIIKGSATVLV
SKMPAARMGDTTAHGGSIVIGAPTVQIGG
 
Nucleotide Sequence: 300 bp     [Download]
>ref|NC_015276.1|:828687-828986 PAAR repeat-containing protein [Marinomonas mediterranea MMB-1]
ATGCCTTGTGCAGCACGTTTAACAGATATGCATACATGCCCAATGCAGACACCTGCGGTACCACCGATTC
CACATGTTGGAGGGCCAATAGTCAGCCCGGGAGCGCCGACGGTACTTATATGCAAATTGCCAGCGGCAAA
AATGGGAGATATGTGTGTCTGTGTCGGTCCTCCAGACAGCATTATTAAGGGAAGTGCGACGGTATTGGTG
AGTAAAATGCCTGCTGCGCGTATGGGAGATACGACTGCACACGGTGGATCCATTGTCATTGGGGCGCCAA
CCGTTCAGATCGGTGGCTAA
 Primer design