SecReT6
Protein ID: 326794070
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0771
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]830124..831506 [+]
Producthypothetical protein
NoteTssA
UniProt IDF2K2K9
KEGG IDmme:Marme_0771
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-11, Aligned region: 62..123
Protein Sequence: 460 a.a.     [Download]
>gi|326794070|ref|YP_004311890.1| hypothetical protein Marme_0771 [Marinomonas mediterranea MMB-1]
MFEELINPISDDQPSGEYLKDNRTLYRGYRNAFNMAQSSFRQLVETPDALEDAEAVNANTDNWANLAEEC
QKCLKETSKDVEIFSWFTVSQLFSNDPFKRLAGALTAFEQVVESNWETLQPTLPEKKRKGEGEDAQAKEV
AEFRVKPLLQLVGDTAESGLLYMPLQMLPLVGETDYGVFFKAEKSGGLSDLKEAAIKALSDERSDVEERI
LALGEAMEALIKLEKTLSEKCFNVGAQSISFRFVKDSIERLLNAIKYLVGDQFTRWPLDPEPEEEPVQEN
NTIETADETPMSEADLSTGAAQPVAQNGVPVGISVAAFSSAGAVASREQALSQLQSIADYFLETEPHSPI
YLLLKRAIRWGGMSLPELLAELVGDNGSVHQRIEQLAGLESAEHESNIKPTAMSTVGAVSHATAAVPSAV
ATASKPAEPSIPTMPVEEKKEENSTSTDSDSNDGLSAIEW
 
Nucleotide Sequence: 1383 bp     [Download]
>ref|NC_015276.1|:830124-831506 hypothetical protein Marme_0771 [Marinomonas mediterranea MMB-1]
ATGTTTGAAGAGTTAATTAACCCGATATCCGACGATCAACCTAGCGGTGAATATCTTAAAGATAATCGCA
CTTTGTACCGCGGGTATCGCAATGCGTTCAATATGGCGCAGTCATCATTTCGACAGTTAGTAGAAACCCC
AGATGCTCTGGAAGATGCAGAAGCTGTAAACGCAAACACGGATAATTGGGCAAATCTCGCAGAAGAATGC
CAGAAATGCCTTAAAGAGACGTCAAAAGACGTAGAGATTTTTTCTTGGTTTACGGTGTCTCAGCTGTTCT
CAAACGACCCGTTCAAACGATTGGCGGGCGCTTTGACCGCATTTGAACAAGTCGTTGAGTCTAACTGGGA
AACATTGCAACCCACGCTTCCAGAAAAAAAGCGAAAGGGAGAGGGTGAAGACGCGCAAGCAAAAGAAGTA
GCAGAGTTTCGTGTTAAACCTCTATTGCAGTTAGTGGGGGATACGGCGGAAAGTGGTCTCTTATACATGC
CGTTGCAAATGCTGCCATTGGTCGGAGAAACGGATTACGGCGTGTTCTTCAAAGCTGAAAAGTCTGGCGG
ACTCTCTGACCTAAAAGAGGCCGCAATCAAGGCATTGTCGGACGAGCGCTCAGACGTTGAAGAACGTATT
CTGGCATTAGGCGAAGCAATGGAAGCGCTCATTAAACTTGAAAAGACACTATCAGAAAAGTGCTTCAATG
TTGGTGCGCAGTCCATCAGTTTTCGCTTTGTAAAGGACTCTATAGAGCGCCTTCTCAATGCAATTAAATA
CTTGGTTGGAGATCAATTTACGCGGTGGCCTTTGGATCCTGAGCCGGAAGAAGAACCTGTTCAGGAAAAC
AACACGATAGAGACCGCCGATGAAACGCCAATGTCAGAGGCTGATCTATCCACTGGTGCAGCGCAACCTG
TAGCGCAAAATGGCGTGCCAGTGGGCATTTCTGTCGCCGCATTTTCTAGCGCGGGTGCGGTCGCATCCAG
AGAGCAGGCGTTATCGCAATTGCAAAGTATCGCGGATTACTTTTTAGAAACAGAGCCGCACAGCCCAATT
TATTTATTGCTTAAGCGCGCGATCAGGTGGGGAGGGATGTCTTTGCCCGAATTGCTTGCCGAATTGGTCG
GAGACAACGGATCTGTGCACCAGCGTATTGAACAACTTGCAGGTTTGGAAAGTGCGGAGCACGAATCCAA
TATCAAACCTACGGCTATGTCGACAGTCGGCGCCGTTTCACATGCAACAGCGGCGGTACCAAGTGCAGTA
GCGACAGCATCGAAACCGGCAGAACCTTCTATACCGACAATGCCAGTGGAAGAGAAAAAAGAAGAGAATT
CAACATCGACAGACAGTGACTCAAACGACGGTCTGTCAGCAATTGAATGGTAG
 Primer design