SecReT6
Protein ID: 326794071
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0772
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]831561..832085 [+]
Producthypothetical protein
NoteTssD
UniProt IDF2K2L0
KEGG IDmme:Marme_0772
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.10E-23, Aligned region: 5..145
Protein Sequence: 174 a.a.     [Download]
>gi|326794071|ref|YP_004311891.1| hypothetical protein Marme_0772 [Marinomonas mediterranea MMB-1]
MASIYMRIDGLNDIKGAATIGDIGGKKGFFAIDTMHWGANRGVHVDVGNANNADKGMVSLDAIGVSRLSD
GASPHLTTFLFAPGAEGKTVEILLTKPSRDGSGADPYLVLTLEKARIASYNIAGSDGNLPSEDFTLTYTT
LTKVYYQEGDGGKIEKGDTVKFDCTTGKLESKAK
 
Nucleotide Sequence: 525 bp     [Download]
>ref|NC_015276.1|:831561-832085 hypothetical protein Marme_0772 [Marinomonas mediterranea MMB-1]
ATGGCTTCTATCTACATGCGAATTGATGGATTAAACGACATCAAAGGTGCTGCAACAATAGGCGATATCG
GTGGCAAAAAAGGCTTTTTTGCTATTGATACAATGCATTGGGGTGCAAACCGTGGTGTACATGTTGATGT
AGGTAATGCAAACAATGCTGACAAAGGCATGGTGTCTTTGGATGCAATTGGTGTTTCTCGTCTTTCTGAC
GGCGCCTCTCCTCACTTGACTACTTTCCTTTTCGCACCAGGTGCAGAAGGTAAGACCGTTGAGATTCTTT
TGACTAAACCGTCACGTGATGGTTCGGGTGCAGATCCTTACCTAGTACTAACGCTAGAAAAGGCGCGTAT
CGCAAGTTACAACATCGCAGGTTCCGATGGCAACCTACCGTCAGAAGATTTCACTTTGACCTACACTACA
TTAACGAAAGTTTATTACCAAGAAGGCGACGGCGGTAAAATCGAAAAAGGTGATACCGTTAAGTTTGATT
GCACTACAGGTAAGCTTGAGTCAAAAGCGAAATAA
 Primer design