SecReT6
Protein ID: 326794072
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0773
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]832109..832606 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDF2K2L1
KEGG IDmme:Marme_0773
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.90E-55, Aligned region: 7..160
Protein Sequence: 165 a.a.     [Download]
>gi|326794072|ref|YP_004311892.1| type VI secretion protein [Marinomonas mediterranea MMB-1]
MALNSQHKRVSKNRVSITYDVETNGAVENKELPFVMGVIGDFSAHKEDREELEDRTFYQIDKDNFDTVLN
RVGPELKLKVDNTLSDDGSQFEAALSFSSMKDFEPDSLIEQVDPLKKLAETRQQLKTLLSKADRSRDLEK
LLKEVLQSADQINALSSELGIEKGE
 
Nucleotide Sequence: 498 bp     [Download]
>ref|NC_015276.1|:832109-832606 type VI secretion protein [Marinomonas mediterranea MMB-1]
ATGGCCTTAAATTCGCAGCATAAGCGTGTCAGTAAAAACCGCGTAAGTATTACTTACGATGTAGAAACAA
ATGGCGCAGTTGAAAACAAAGAACTGCCATTTGTTATGGGTGTGATAGGGGATTTTTCTGCACACAAAGA
AGATCGTGAAGAGTTGGAGGATCGCACCTTCTACCAGATCGATAAAGACAACTTTGATACAGTCCTTAAC
CGAGTGGGACCAGAATTAAAGTTAAAAGTTGATAACACTTTGTCTGATGATGGCAGCCAATTTGAGGCAG
CGTTGTCTTTCTCTTCTATGAAAGATTTCGAACCAGATTCTTTGATCGAACAAGTAGACCCTCTGAAGAA
ATTAGCAGAGACCCGTCAGCAGTTAAAAACGCTACTTTCTAAAGCAGACCGCTCACGCGATCTTGAGAAG
CTTTTAAAAGAAGTGCTACAAAGCGCGGATCAAATCAACGCATTGTCTAGCGAGCTTGGCATCGAGAAAG
GAGAATAA
 Primer design