SecReT6
Protein ID: 326794074
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0775
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]834105..835544 [+]
Producthypothetical protein
NoteTssC
UniProt IDF2K2L3
KEGG IDmme:Marme_0775
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.20E-117, Aligned region: 51..465
Protein Sequence: 479 a.a.     [Download]
>gi|326794074|ref|YP_004311894.1| hypothetical protein Marme_0775 [Marinomonas mediterranea MMB-1]
MGESMLSLQLQTDLCGLDTDEQGFLEKALRLLVTLDPQILLNRDTLFAAVSRLISEIDTRVSSQVSQLLH
HPDFKQLEAAWRGVEVLTSLPVSNQKTRVKILNLSWPDLSYELNNALTLRRSYLYNLIGNRELNTSGGQP
FGMIVVDHALSTDLDSDFDDLYTAELLANLGDLCLCPFILSSADDFFGEEGADWASDTRRVKKILEGPDF
VAWQHLRKQSVSRFLGVTLPKVKMRTEYAPQPFSGVVFTEEEEVKPGLWGNSAFLFASIAMREFNRINWF
GFMKSRWQDKYYGALVNVPPNGIGSFATLSPCPDIRIITDMGNFYSDQGFIPLCHSLTTDKYFFRGNNSI
WDHAKGDAEAVMGQIQTTLMICRIAHYLKVQIRGMIGNFQTAEECENFLNNWLDRYSSNLFNADEATLAK
YPLSRGRVEVKEIEGQQGRYTCDVLVQPQYQFDNVCGEVLLSTDLGSEASGYGYVGGRA
 
Nucleotide Sequence: 1440 bp     [Download]
>ref|NC_015276.1|:834105-835544 hypothetical protein Marme_0775 [Marinomonas mediterranea MMB-1]
TTGGGTGAGAGTATGCTGAGTTTGCAATTACAAACCGATCTGTGTGGTCTAGACACTGATGAGCAAGGCT
TTTTAGAAAAAGCCCTGCGTCTTTTAGTGACGTTAGATCCACAGATATTATTGAATCGCGATACGCTATT
TGCGGCCGTGTCTAGGCTGATTTCAGAAATAGATACTCGCGTTTCGTCGCAAGTTTCACAGCTGCTTCAT
CACCCTGACTTTAAACAATTGGAAGCGGCGTGGCGAGGTGTTGAGGTTTTGACATCTTTGCCCGTTAGCA
ACCAGAAAACGCGCGTTAAAATTCTAAATTTATCGTGGCCTGACCTTTCATATGAACTGAATAATGCGCT
TACACTGCGTCGTTCGTATTTGTATAACTTGATAGGAAATAGAGAGTTAAATACGTCTGGAGGTCAGCCG
TTTGGCATGATTGTCGTCGACCATGCGCTGTCTACTGATTTAGACAGTGACTTTGACGACTTATATACTG
CGGAATTACTAGCCAATTTAGGTGACTTATGTCTTTGCCCTTTTATTCTATCGTCCGCGGATGACTTTTT
TGGTGAAGAAGGGGCGGATTGGGCATCCGATACGCGTCGTGTCAAAAAAATTCTAGAAGGGCCTGATTTT
GTTGCGTGGCAGCATTTAAGGAAGCAGTCGGTATCTCGTTTTCTCGGCGTTACTTTGCCTAAGGTAAAAA
TGAGAACGGAGTACGCGCCTCAGCCGTTCTCAGGCGTTGTATTTACCGAAGAAGAGGAAGTCAAACCGGG
CTTATGGGGAAACTCCGCATTTTTATTTGCTTCTATTGCGATGCGGGAGTTTAACCGCATCAATTGGTTT
GGCTTTATGAAATCCCGCTGGCAAGACAAATACTACGGTGCATTAGTGAACGTGCCACCGAATGGAATCG
GGTCGTTTGCAACCTTATCACCTTGTCCAGATATTCGCATTATCACAGACATGGGGAATTTCTATTCGGA
TCAGGGCTTTATTCCTCTTTGCCATAGTTTGACTACAGATAAGTACTTTTTTCGTGGTAATAACTCTATT
TGGGATCATGCAAAAGGCGATGCTGAAGCGGTCATGGGGCAGATTCAAACGACACTGATGATTTGTCGTA
TTGCGCATTATTTGAAGGTTCAAATTCGCGGCATGATCGGTAACTTTCAAACCGCAGAAGAGTGTGAAAA
CTTCTTAAATAACTGGTTAGATCGGTACTCCAGTAACCTCTTTAATGCTGATGAAGCGACGTTGGCGAAA
TACCCGTTGAGTAGAGGTCGAGTGGAGGTAAAAGAAATCGAAGGACAGCAAGGGCGCTATACGTGTGATG
TTTTAGTGCAGCCTCAGTACCAGTTTGATAATGTGTGCGGTGAAGTCCTTTTGTCCACCGATTTGGGCTC
TGAAGCGTCCGGGTACGGGTATGTCGGAGGTCGGGCATGA
 Primer design