SecReT6
Protein ID: 326794075
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0776
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]835541..835960 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDF2K2L4
KEGG IDmme:Marme_0776
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.30E-14, Aligned region: 13..112
Protein Sequence: 139 a.a.     [Download]
>gi|326794075|ref|YP_004311895.1| GPW/gp25 family protein [Marinomonas mediterranea MMB-1]
MSFWGTFIDQGASNDSLLESIRYQLTSLLNSEAPMRALPEGFDEVKSSNFSFGLDSAHSISSQINHDQFS
RSLEKWIKTFEPRLTDVSVFIEESNPSKNIMSFSLMAKVDTGDGSHVFLFDSNISLSNQVARMEGQEVV
 
Nucleotide Sequence: 420 bp     [Download]
>ref|NC_015276.1|:835541-835960 GPW/gp25 family protein [Marinomonas mediterranea MMB-1]
ATGAGTTTCTGGGGAACCTTCATAGACCAAGGCGCGAGTAATGACTCGCTACTAGAGTCAATTCGTTATC
AGCTTACTTCTCTGCTGAATTCAGAAGCGCCAATGCGGGCTTTGCCAGAAGGTTTTGATGAGGTTAAATC
CTCTAATTTCAGCTTCGGTCTCGACAGCGCTCATAGTATAAGCAGTCAAATCAACCATGACCAATTTTCT
CGCTCACTCGAAAAGTGGATTAAGACGTTTGAGCCGAGGCTTACTGATGTCAGCGTATTCATAGAAGAGA
GCAACCCTTCTAAAAATATTATGAGTTTTTCGTTGATGGCAAAAGTAGACACGGGTGATGGCAGCCACGT
TTTTTTGTTCGACTCTAATATCAGTCTTTCAAATCAGGTAGCCAGAATGGAGGGACAGGAAGTTGTCTGA
 Primer design