SecReT6
Protein ID: 326794076
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0777
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]835953..837758 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDF2K2L5
KEGG IDmme:Marme_0777
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.30E-117, Aligned region: 5..599
Protein Sequence: 601 a.a.     [Download]
>gi|326794076|ref|YP_004311896.1| type VI secretion protein [Marinomonas mediterranea MMB-1]
MSDQLLSYFERELAYVRRALDSFGSEFPDHAASMRLNQTGQEDPNISRLIDAMALLTAKTEKRIDEQLPD
VLQDLFSVLYPGYLQIIPSYTPLMVELGDDPITERVVLPKGSQASLMVKEAECLFSLAEDLIIEPFIIKD
IQAESAPFNFPTPKTVRRAESVVQITLNCSDPSVFFSQLDFTSSSLGKDKNDHFDFYVRGFENSSRGLID
LLLLNTEAISLFDEQGNQVEIDTKRLVSRAADPSFNWLPNHGNHQIGFDLVREYFAYPDKAAYIRLEGLY
KELSRFQSSTVTLNFFVQQLPVEYLRLFNRQVFLLNTTPAINLYPQRGEPMRYDFTKLSIPVVADTQANN
ELTVVSVEKVCEVLPTGEVELSPIYEGGYWFDDSAPKWQVRQFWDEKGRRLMDLSVSYGSEVTAQDAVVL
SMSLKVCNGRLPCLVPSYSHAESYAAVDIPGELKNVRTPTAPQYPALDNQLSWRFVAMLNANFSSLTQAD
DATRALQDVLRLSTHSIQCKVADSIKNVSYKHLVAPITIDRQSIFASGTQVTILIDDELLGADFAVVSNV
LNGFYQQYCSFDRFMQVNVERFGSDVPGIEFEKCHGSQLCL
 
Nucleotide Sequence: 1806 bp     [Download]
>ref|NC_015276.1|:835953-837758 type VI secretion protein [Marinomonas mediterranea MMB-1]
TTGTCTGATCAGCTCCTAAGTTATTTTGAACGTGAGCTTGCCTACGTAAGGCGTGCTCTAGATTCTTTCG
GTAGTGAGTTCCCTGATCACGCCGCGTCAATGCGTCTTAACCAAACGGGTCAAGAAGACCCTAATATTAG
TCGTTTGATTGACGCCATGGCGTTGCTTACAGCAAAAACAGAAAAACGTATCGATGAGCAACTTCCAGAC
GTTCTGCAAGATCTGTTTAGTGTCTTGTACCCTGGCTACCTTCAAATTATCCCAAGTTATACGCCTTTAA
TGGTGGAACTGGGTGATGACCCGATAACTGAACGCGTTGTGTTACCAAAGGGGTCGCAAGCATCGCTTAT
GGTGAAAGAGGCGGAATGTCTTTTTAGCCTTGCTGAAGATTTGATTATCGAACCTTTCATTATCAAAGAC
ATTCAGGCGGAATCTGCACCCTTTAACTTCCCTACACCTAAAACCGTGCGTCGAGCTGAGTCAGTAGTTC
AGATTACGCTTAACTGCAGCGATCCAAGTGTGTTCTTTTCTCAGTTGGACTTTACATCGTCTTCTCTTGG
GAAAGATAAAAACGATCATTTTGATTTCTATGTTCGAGGGTTTGAGAACAGTTCTCGTGGGCTCATTGAT
TTATTGCTTTTGAATACAGAAGCGATTTCATTGTTTGATGAGCAAGGCAATCAGGTTGAGATTGATACAA
AGCGTCTAGTATCGCGCGCTGCTGATCCTTCATTTAATTGGCTGCCCAATCATGGGAATCACCAGATTGG
TTTTGATCTAGTGCGGGAGTATTTCGCTTACCCTGATAAAGCCGCCTACATTCGGCTGGAAGGTTTGTAT
AAAGAGTTGTCTCGATTCCAATCAAGCACAGTGACGTTGAACTTTTTTGTACAACAACTACCGGTTGAAT
ATTTACGATTGTTTAATCGTCAGGTGTTTCTATTGAATACGACGCCAGCGATTAACCTTTATCCGCAGCG
CGGCGAGCCAATGCGATATGACTTTACTAAATTGTCTATTCCTGTTGTGGCTGATACGCAAGCTAACAAC
GAATTGACTGTGGTATCGGTTGAAAAAGTCTGCGAAGTGCTGCCAACCGGAGAAGTGGAACTTAGTCCGA
TTTACGAGGGCGGTTACTGGTTTGACGACAGTGCGCCGAAATGGCAAGTACGTCAGTTTTGGGATGAAAA
AGGCCGCAGACTTATGGATCTGTCTGTTAGTTATGGCTCTGAGGTAACAGCCCAAGATGCGGTGGTTTTA
TCCATGTCACTTAAGGTCTGCAATGGCCGCTTGCCGTGTTTAGTCCCCAGTTACTCACACGCTGAGTCGT
ATGCAGCGGTGGATATTCCCGGAGAACTCAAGAACGTTCGTACTCCAACGGCGCCTCAATATCCTGCCTT
GGATAATCAATTAAGTTGGCGATTTGTTGCCATGTTGAATGCGAATTTTTCCAGCCTTACTCAGGCAGAT
GACGCGACTAGAGCCTTACAAGATGTGTTGCGTTTGAGCACTCATAGCATTCAGTGCAAAGTGGCGGATT
CGATAAAAAATGTGAGCTATAAACACCTCGTTGCTCCAATTACGATTGACCGGCAGAGCATATTTGCCTC
CGGTACGCAGGTGACGATTTTGATTGATGATGAACTGTTGGGCGCTGATTTTGCGGTGGTCAGCAATGTG
CTCAACGGTTTCTACCAGCAGTATTGTAGTTTTGATCGGTTCATGCAGGTTAATGTGGAGCGCTTCGGGA
GTGATGTTCCGGGAATTGAATTCGAAAAATGTCACGGGAGTCAGCTATGTCTGTGA
 Primer design