SecReT6
Protein ID: 326794077
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0778
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]837749..838738 [+]
Producthypothetical protein
NoteTssG
UniProt IDF2K2L6
KEGG IDmme:Marme_0778
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.90E-39, Aligned region: 9..311
Protein Sequence: 329 a.a.     [Download]
>gi|326794077|ref|YP_004311897.1| hypothetical protein Marme_0778 [Marinomonas mediterranea MMB-1]
MSVTKRLLERPHTFNFAQATRILTSLSESKGMELSLQSDPMPHGAPTDIMSIQQNGKELRVKLGLEALSG
CKGVIPDYLYAELLNSLHQDDEALQRFLDVFNQRYYELVAYVESTASVLLREEREVAIGRALNRLTQQSA
LTHLFALPRQKQEGSDPSLIRYGLAMANKSRSLSGLKRLLCDYFSLDITPRAIASRLYRISPAFQTRIGT
RLGQNHKLGHGVLLGNKGAQAYKTLEVCITPRSKKEYLGLLNNRHFSNALQTLALSYLRESVTTKIYLYV
KREYIDAPVLSSGALSSGHHAFRLGETNCLAPERRATEYRKILLQSEKG
 
Nucleotide Sequence: 990 bp     [Download]
>ref|NC_015276.1|:837749-838738 hypothetical protein Marme_0778 [Marinomonas mediterranea MMB-1]
ATGTCTGTGACAAAGAGGCTTTTAGAGCGTCCACATACGTTTAACTTTGCTCAAGCGACGCGGATATTAA
CGTCTCTTAGTGAGAGTAAGGGGATGGAACTCAGCCTGCAATCTGATCCGATGCCACATGGCGCACCGAC
TGACATCATGTCAATTCAGCAAAACGGTAAAGAGCTTCGTGTGAAGTTAGGGCTTGAAGCATTATCTGGC
TGCAAAGGTGTTATTCCTGATTACCTATATGCGGAATTACTGAATAGCCTGCATCAAGATGATGAGGCGC
TACAACGCTTTTTAGATGTGTTCAATCAGCGTTATTACGAGCTAGTCGCGTATGTAGAGAGCACTGCGAG
TGTTTTGCTTAGAGAAGAGCGCGAGGTGGCAATAGGGCGAGCTCTAAACAGATTAACTCAACAAAGCGCA
TTGACACATTTGTTTGCCTTACCGCGTCAAAAACAAGAAGGCAGTGATCCAAGTTTGATTCGATATGGTT
TGGCCATGGCGAATAAGAGTCGCAGTTTATCTGGCTTAAAGCGTTTGCTATGCGACTATTTTTCGCTCGA
TATCACCCCACGAGCGATTGCATCAAGGTTGTATCGAATTAGTCCCGCTTTTCAAACGAGAATCGGAACC
CGCTTAGGGCAAAATCATAAACTTGGGCATGGCGTGCTATTGGGGAACAAAGGGGCGCAAGCCTACAAAA
CATTGGAGGTGTGCATAACGCCTCGTTCCAAAAAAGAATATTTAGGTCTTTTAAATAATCGCCACTTTTC
CAATGCTTTACAGACATTAGCGCTTTCCTACTTGAGAGAGAGTGTCACAACCAAAATCTATCTATATGTA
AAACGAGAATACATCGATGCGCCTGTCTTATCGTCTGGCGCTTTGTCGTCAGGCCATCATGCGTTTCGTT
TGGGAGAGACCAACTGTCTCGCACCAGAGCGTCGTGCCACTGAATATCGCAAAATACTATTACAATCGGA
GAAAGGCTAA
 Primer design