SecReT6
Protein ID: 326794078
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0779
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]838738..841359 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDF2K2L7
KEGG IDmme:Marme_0779
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.70E-40, Aligned region: 224..240
AAA_2 [PF07724], Evalue: 5.70E-40, Aligned region: 603..770
AAA [PF00004], Evalue: 3.60E-21, Aligned region: 223..355
AAA [PF00004], Evalue: 3.60E-21, Aligned region: 468..528
AAA [PF00004], Evalue: 3.60E-21, Aligned region: 609..729
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 78..111
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 223..245
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 312..353
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 427..498
AAA_5 [PF07728], Evalue: 1.30E-13, Aligned region: 608..729
ClpB_D2-small [PF10431], Evalue: 2.50E-13, Aligned region: 776..848
AAA_22 [PF13401], Evalue: 3.40E-09, Aligned region: 223..308
AAA_22 [PF13401], Evalue: 3.40E-09, Aligned region: 340..383
AAA_22 [PF13401], Evalue: 3.40E-09, Aligned region: 607..688
AAA_22 [PF13401], Evalue: 3.40E-09, Aligned region: 788..819
AAA_16 [PF13191], Evalue: 6.40E-09, Aligned region: 201..243
AAA_16 [PF13191], Evalue: 6.40E-09, Aligned region: 267..302
AAA_16 [PF13191], Evalue: 6.40E-09, Aligned region: 371..519
AAA_16 [PF13191], Evalue: 6.40E-09, Aligned region: 599..629
AAA_16 [PF13191], Evalue: 6.40E-09, Aligned region: 674..702
Zeta_toxin [PF06414], Evalue: 1.30E-06, Aligned region: 222..240
Zeta_toxin [PF06414], Evalue: 1.30E-06, Aligned region: 303..371
Zeta_toxin [PF06414], Evalue: 1.30E-06, Aligned region: 600..648
AAA_17 [PF13207], Evalue: 3.70E-06, Aligned region: 223..273
AAA_17 [PF13207], Evalue: 3.70E-06, Aligned region: 452..483
AAA_17 [PF13207], Evalue: 3.70E-06, Aligned region: 608..643
IstB_IS21 [PF01695], Evalue: 8.30E-06, Aligned region: 218..245
IstB_IS21 [PF01695], Evalue: 8.30E-06, Aligned region: 608..630
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 223..247
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 279..317
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 605..636
AAA_25 [PF13481], Evalue: 5.20E-05, Aligned region: 673..692
Clp_N [PF02861], Evalue: 0.00013, Aligned region: 36..73
Clp_N [PF02861], Evalue: 0.00013, Aligned region: 106..128
AAA_10 [PF12846], Evalue: 0.00025, Aligned region: 96..114
AAA_10 [PF12846], Evalue: 0.00025, Aligned region: 223..247
AAA_10 [PF12846], Evalue: 0.00025, Aligned region: 289..312
AAA_10 [PF12846], Evalue: 0.00025, Aligned region: 461..536
AAA_10 [PF12846], Evalue: 0.00025, Aligned region: 608..792
AAA_18 [PF13238], Evalue: 0.00028, Aligned region: 223..248
AAA_18 [PF13238], Evalue: 0.00028, Aligned region: 498..522
AAA_18 [PF13238], Evalue: 0.00028, Aligned region: 611..639
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 220..244
AAA_19 [PF13245], Evalue: 0.00029, Aligned region: 606..630
Sigma54_activat [PF00158], Evalue: 0.00059, Aligned region: 220..237
Sigma54_activat [PF00158], Evalue: 0.00059, Aligned region: 608..729
RNA_helicase [PF00910], Evalue: 0.00065, Aligned region: 224..244
RNA_helicase [PF00910], Evalue: 0.00065, Aligned region: 609..630
RNA_helicase [PF00910], Evalue: 0.00065, Aligned region: 706..726
AAA_33 [PF13671], Evalue: 0.0011, Aligned region: 223..240
AAA_33 [PF13671], Evalue: 0.0011, Aligned region: 444..466
AAA_33 [PF13671], Evalue: 0.0011, Aligned region: 607..627
RuvB_N [PF05496], Evalue: 0.0012, Aligned region: 222..238
RuvB_N [PF05496], Evalue: 0.0012, Aligned region: 281..303
RuvB_N [PF05496], Evalue: 0.0012, Aligned region: 568..629
RuvB_N [PF05496], Evalue: 0.0012, Aligned region: 677..701
NACHT [PF05729], Evalue: 0.0027, Aligned region: 223..250
NACHT [PF05729], Evalue: 0.0027, Aligned region: 609..633
Mg_chelatase [PF01078], Evalue: 0.0061, Aligned region: 219..246
Mg_chelatase [PF01078], Evalue: 0.0061, Aligned region: 608..625
Mg_chelatase [PF01078], Evalue: 0.0061, Aligned region: 638..726
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 223..245
SRP54 [PF00448], Evalue: 0.0075, Aligned region: 607..635
TIP49 [PF06068], Evalue: 0.01, Aligned region: 223..262
TIP49 [PF06068], Evalue: 0.01, Aligned region: 272..303
TIP49 [PF06068], Evalue: 0.01, Aligned region: 607..629
Protein Sequence: 873 a.a.     [Download]
>gi|326794078|ref|YP_004311898.1| type VI secretion ATPase, ClpV1 family [Marinomonas mediterranea MMB-1]
MSQVKLGNLVGKLEPELKNALEEAAGSAMKQTVPAIEVEHWFIQLIVNKEVNLNSFFQRQKIDLNGLLTE
LTARVERLVKGATGQPTISATVSEAMEEAWLIASVNYGHGQITSLHLLQALVQSDSFGMKKLSLESLQNV
STEALSAHIAQLKVAGVSSSSSASPSAAEGATAAPVAGGALDKYTVNLTQQARDGKIDPISGRNSEVRLA
IDILCRKRQNNPILVGEPGVGKTAVVEGLALRIVEGEVPPVIQGVEIHSLDLGLLQAGASIKGEFENRLK
DVINEVKSSETPIIVFIDEAHTLIGAGGAAGQNDAANLLKPALARGEFRSIAATTWAEYKKYFEKDPALT
RRFQVVKVEEPDAEDALQMLRGVAASLRKHHGVFIREDALEAAVHLSIRYLPARQLPDKAISLLDTSCAR
IALTQGAKPEKVEQLEQQIRYLNSELSAFEVEDAVLTDQAEDRDALRDSIAEKEAELELLMARWEQEKSL
VDEITVLSEDIEANLKEGADATKQAALQTKMDDLSKLQGDDPLVFALVDSQVIASVIESWTGIPAGNMVK
GEVAELLSLEDALHKRVIGQQAGISELAKSIRISRAGLTDSRKPVGVFLMCGPSGVGKTETAMALADEVF
GGGDNLTVINMTEFKEEHKISMLLGSPAGYVGFGEGGVLTEAIRRNPYSVLLLDEMEKAHPGVHDLFYQI
FDKGHIKDSEGRTIDFKNTIIVMTSNAADQAICDICNAAEDRPVNEELVEEIRPALQQYFKPAFLGRATI
VPYYPLNAEELGKITEISLNRIAKKLNEKYKAEFSWDDSFIEFVVSRNTDPTTGGRAIEQIINRSLMPRL
AEQCIQRLSEGLPIERVSVTIEPMTADLSLHIE
 
Nucleotide Sequence: 2622 bp     [Download]
>ref|NC_015276.1|:838738-841359 type VI secretion ATPase, ClpV1 family [Marinomonas mediterranea MMB-1]
ATGTCACAGGTAAAGTTAGGCAATCTTGTCGGAAAATTAGAGCCTGAGCTAAAGAATGCGCTTGAAGAAG
CCGCTGGGTCAGCAATGAAGCAAACAGTACCTGCTATTGAGGTTGAGCACTGGTTTATTCAGCTCATCGT
CAATAAAGAGGTAAATCTAAATTCTTTTTTCCAACGTCAAAAAATTGATTTAAACGGATTGCTGACGGAG
CTGACTGCCCGAGTTGAGCGTCTTGTAAAAGGGGCAACCGGACAGCCGACTATCAGTGCAACAGTCAGTG
AAGCGATGGAGGAAGCATGGTTAATTGCATCCGTTAATTATGGTCATGGTCAAATTACAAGCTTGCATCT
GTTGCAGGCACTTGTTCAGTCAGACAGCTTTGGTATGAAGAAACTGTCTTTGGAGTCGCTTCAGAATGTT
TCAACGGAAGCCTTGTCCGCACACATTGCCCAACTTAAAGTCGCAGGCGTTTCCAGTTCTTCATCAGCGT
CGCCTAGTGCAGCAGAAGGCGCAACAGCCGCCCCTGTTGCGGGTGGTGCGTTGGACAAATACACTGTCAA
CCTGACTCAACAAGCGCGCGATGGAAAAATTGACCCAATCTCAGGTCGAAACAGTGAAGTTCGCTTAGCG
ATTGATATTCTGTGCCGTAAGAGACAAAACAATCCAATATTGGTGGGCGAGCCTGGAGTTGGTAAAACGG
CCGTCGTTGAAGGCTTGGCGCTTCGAATTGTCGAAGGTGAAGTGCCTCCTGTTATTCAAGGTGTCGAAAT
CCATTCACTTGACCTCGGTCTTCTCCAAGCAGGCGCAAGCATTAAAGGGGAGTTTGAGAACCGTCTTAAA
GACGTTATCAATGAAGTGAAGAGCTCAGAAACACCAATCATCGTCTTTATAGACGAGGCGCATACCTTGA
TTGGTGCTGGTGGCGCAGCGGGACAAAATGACGCCGCAAACTTATTGAAACCCGCGTTAGCGCGTGGAGA
ATTCCGCTCGATTGCAGCAACAACATGGGCTGAATACAAAAAGTATTTCGAGAAAGACCCTGCATTAACT
CGTCGTTTTCAGGTAGTTAAAGTTGAAGAGCCTGACGCTGAAGATGCATTGCAAATGTTACGTGGTGTAG
CGGCGTCATTACGAAAACACCACGGTGTCTTTATACGTGAAGATGCGCTCGAAGCAGCGGTACACTTATC
CATTCGTTATCTTCCTGCTCGTCAATTGCCAGATAAAGCGATTAGCCTTTTGGATACCTCATGTGCCCGT
ATTGCGTTAACTCAAGGCGCGAAACCTGAAAAAGTAGAGCAGCTTGAACAACAAATTCGCTACTTAAACA
GCGAGCTGTCGGCATTTGAAGTGGAAGATGCCGTTCTCACTGATCAGGCAGAGGATCGCGACGCTTTGCG
TGACAGCATTGCTGAAAAAGAGGCTGAGCTTGAGTTATTGATGGCACGTTGGGAGCAAGAAAAGTCGCTT
GTTGATGAGATCACCGTTTTAAGTGAGGACATTGAGGCTAATCTTAAAGAAGGTGCGGACGCGACTAAAC
AGGCAGCACTTCAAACGAAAATGGATGATTTGTCTAAGTTGCAAGGCGATGATCCCCTCGTGTTTGCACT
GGTTGATAGCCAAGTCATTGCATCAGTCATTGAGAGTTGGACGGGAATTCCTGCTGGCAACATGGTGAAA
GGTGAAGTTGCTGAGCTTTTATCTCTTGAAGATGCATTACATAAGCGCGTTATCGGACAACAAGCGGGGA
TTAGTGAGCTTGCTAAGAGCATTCGTATTTCTCGTGCCGGCTTAACGGATAGCCGAAAACCGGTTGGTGT
TTTCTTGATGTGCGGTCCAAGTGGTGTGGGTAAAACCGAAACTGCCATGGCACTTGCCGATGAAGTGTTT
GGCGGTGGGGATAACTTGACGGTTATCAACATGACTGAGTTTAAAGAAGAGCATAAAATCTCTATGTTAT
TGGGCTCGCCTGCTGGGTATGTCGGGTTCGGTGAAGGTGGTGTATTAACCGAAGCCATTCGCCGTAATCC
ATACTCCGTTTTATTATTGGATGAAATGGAAAAAGCGCATCCAGGCGTACATGATTTGTTTTATCAGATT
TTCGACAAAGGCCACATAAAAGACAGTGAAGGCCGTACGATCGACTTTAAGAATACGATTATTGTGATGA
CGTCAAATGCGGCTGATCAAGCTATCTGCGATATCTGTAATGCGGCTGAAGATCGCCCTGTTAATGAAGA
GCTTGTCGAAGAGATTCGCCCTGCACTTCAGCAATACTTCAAGCCTGCCTTTCTTGGGCGCGCGACCATC
GTGCCTTACTACCCATTAAATGCAGAAGAGCTTGGTAAGATCACTGAAATCAGTTTGAATCGAATTGCCA
AAAAATTAAATGAAAAATACAAAGCGGAATTTAGCTGGGACGACTCTTTTATCGAGTTTGTTGTCTCGCG
CAATACGGATCCGACTACTGGTGGACGCGCTATTGAGCAAATTATCAATCGTTCACTTATGCCGCGATTG
GCAGAGCAATGTATTCAACGATTAAGTGAAGGATTACCCATTGAACGAGTGTCAGTGACCATTGAGCCAA
TGACAGCCGATTTGTCGCTTCATATAGAATAA
 Primer design