SecReT6
Protein ID: 326794080
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0781
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]842162..843184 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDF2K2L9
KEGG IDmme:Marme_0781
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-16, Aligned region: 29..96
Protein Sequence: 340 a.a.     [Download]
>gi|326794080|ref|YP_004311900.1| FHA domain-containing protein [Marinomonas mediterranea MMB-1]
MTVSFQLIELPDNEQVASRQVSLPDSGGTIGRSFECTIQLPDFGRTLSRVHAEVLPHPKGGYQIVDRSTN
GVFVNDILLGKGEAQRLSDGDNVRIGAYTLLFSDMESLFALENDEVTAPKPVKDERLSDQASPFSLDEVL
NDKNDATLGIESTLSGDSGAKEGLSKKEDSAFSADNVLGEDSYGYDPFEDDERWAMEQPQEQDDSVEEIV
MIEEAEPEMGEATSTLPNRSLAVTESAQVAALENSISRLNSIIEQQQRTLSTSVDRESLVACIESTLDKF
LDDLNPEQLEDEFNDYISGWGKKDKKYWSLYKKQFNRKKERREFYRQFSALLFEELRDKR
 
Nucleotide Sequence: 1023 bp     [Download]
>ref|NC_015276.1|:842162-843184 FHA domain-containing protein [Marinomonas mediterranea MMB-1]
ATGACCGTTAGCTTTCAGCTGATTGAATTACCAGATAACGAGCAGGTTGCTAGTCGACAGGTGTCCTTGC
CTGATTCAGGTGGCACGATTGGGCGATCGTTCGAATGTACGATACAGCTTCCTGATTTTGGACGAACACT
TTCTAGAGTGCATGCCGAAGTGCTTCCGCACCCAAAAGGTGGGTACCAAATAGTCGACAGAAGTACGAAT
GGGGTATTTGTTAATGACATTCTTCTTGGCAAAGGTGAAGCGCAACGTTTAAGTGACGGCGATAACGTTC
GGATAGGGGCATACACTCTCTTATTTAGTGATATGGAATCATTGTTTGCATTAGAGAATGATGAGGTAAC
AGCGCCTAAGCCAGTGAAAGACGAGCGGTTAAGCGATCAGGCATCGCCCTTTAGTTTAGATGAAGTGTTG
AATGATAAAAATGATGCCACATTGGGGATAGAAAGCACGCTCTCGGGCGATAGTGGGGCAAAAGAAGGGC
TGTCAAAGAAAGAGGATTCAGCGTTTTCAGCGGACAATGTGCTGGGCGAAGATTCATATGGCTACGACCC
TTTTGAGGATGACGAGCGTTGGGCAATGGAGCAGCCGCAAGAGCAAGATGATAGCGTAGAAGAGATTGTG
ATGATTGAAGAAGCGGAACCCGAAATGGGTGAGGCGACGTCAACACTACCCAATCGATCTCTCGCAGTGA
CGGAAAGTGCGCAGGTTGCAGCGTTGGAAAACAGCATCAGTCGCTTGAATAGTATCATCGAGCAACAACA
ACGCACCTTGTCGACTTCTGTCGATCGCGAAAGTCTTGTGGCATGCATAGAGTCTACACTAGATAAGTTT
TTAGATGATTTGAACCCAGAGCAATTAGAAGACGAGTTTAATGACTATATCTCTGGTTGGGGTAAGAAAG
ATAAAAAGTATTGGTCACTATACAAAAAACAATTTAATCGTAAAAAGGAACGACGTGAATTTTATCGTCA
GTTCTCAGCGTTGTTGTTTGAAGAGTTGAGAGACAAACGATGA
 Primer design