SecReT6
Protein ID: 326794081
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0782
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]843196..843693 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDF2K2M0
KEGG IDmme:Marme_0782
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-31, Aligned region: 13..151
Protein Sequence: 165 a.a.     [Download]
>gi|326794081|ref|YP_004311901.1| type VI secretion lipoprotein [Marinomonas mediterranea MMB-1]
MIRLITLGSLLGLVLVGCSSTSNSAFQPALNIELNIEATGDINVFEDGEARPVILRIYQLNDVGNFDKAS
FTRLYSDDQSALAGSLIDTKQLSAVLPGEKRTLVLDVQQQAKFLAVFAEFSNYETATSKSSVALVEEPES
YPVFIAITHDKVEITQPVKEAWWKF
 
Nucleotide Sequence: 498 bp     [Download]
>ref|NC_015276.1|:843196-843693 type VI secretion lipoprotein [Marinomonas mediterranea MMB-1]
ATGATTCGGTTGATCACATTAGGCAGCCTTTTAGGCTTAGTTTTGGTCGGCTGTAGTTCAACGAGCAATA
GCGCGTTTCAACCAGCGCTAAATATTGAGCTAAATATTGAAGCGACTGGAGACATTAATGTATTTGAGGA
TGGTGAAGCAAGGCCTGTTATCTTGCGTATATACCAACTCAACGATGTAGGTAACTTTGATAAAGCGAGC
TTTACCCGTTTATACAGTGATGACCAGAGTGCGCTGGCGGGTTCATTAATTGACACTAAGCAATTGTCAG
CCGTGCTTCCGGGGGAAAAAAGAACGCTCGTGTTAGATGTGCAGCAGCAAGCAAAATTTCTAGCTGTATT
TGCAGAATTTTCGAATTATGAAACCGCCACCTCAAAGTCCTCAGTTGCCTTGGTGGAAGAACCAGAAAGT
TACCCCGTTTTTATTGCCATCACGCATGACAAAGTTGAGATTACGCAACCGGTCAAAGAAGCGTGGTGGA
AGTTTTAA
 Primer design