SecReT6
Protein ID: 326794082
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0783
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]843712..845037 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDF2K2M1
KEGG IDmme:Marme_0783
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-103, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|326794082|ref|YP_004311902.1| type VI secretion protein [Marinomonas mediterranea MMB-1]
MKHHSKVVWKEGMFIAPQHFQQQERHITQYIQKYISLTSEGRSFGVSLLEIEHNYLKLGKFSVTHCSGVF
PDGTLFDCSKELLLEIPEGTINKRIFLGLPLAVEGENEYGEAAEQRRFALGNISLFDSSDESQSAIEAQV
ADPNIRLVIEGEDITGLALLPIARILERREDVNVVLDKSFIPTCLQYGASQLLKERIKELYILTEARAQS
VVQRIGIGQQTKSDLSLMREFLWLQTLNRWIPWLHLTLEQPETRIEALYEGLLAFSGELESFKPAVVQAP
KPLNRDDLKSVFGHLFSELREKLSMVQSDSVTEFSWDENLFERRRLLRLSIPNLNQMEGRRFVISVQSSM
GTPALSQVFPSACTLSGLSKIADLVRNSQSGVGIHLLPVAPSELKAQADVAYFEIDSAHEYWTQLKAKRE
PIALHVDSRVPDLSIKLYALG
 
Nucleotide Sequence: 1326 bp     [Download]
>ref|NC_015276.1|:843712-845037 type VI secretion protein [Marinomonas mediterranea MMB-1]
TTGAAACATCACAGTAAAGTTGTTTGGAAGGAGGGGATGTTTATTGCCCCTCAACACTTTCAGCAACAAG
AGCGCCATATTACGCAATATATTCAAAAGTACATTTCTTTGACTTCTGAAGGTCGGAGTTTTGGTGTCTC
TCTTCTTGAAATTGAGCATAACTATTTAAAACTAGGCAAGTTTAGTGTGACTCATTGCAGTGGCGTATTC
CCTGATGGGACGTTATTTGACTGCTCAAAAGAGCTGTTGCTTGAGATTCCTGAAGGAACCATAAATAAAC
GAATTTTCCTTGGACTTCCCCTCGCGGTAGAGGGTGAAAATGAATATGGCGAAGCAGCGGAGCAACGCCG
CTTCGCATTGGGCAACATTAGTTTGTTTGATTCTAGCGATGAGAGTCAAAGCGCGATTGAAGCTCAGGTC
GCTGATCCTAATATTCGCTTAGTGATAGAAGGGGAAGATATAACGGGCTTAGCACTTTTACCAATCGCGC
GTATTTTAGAGCGTCGCGAAGATGTTAATGTTGTGCTGGATAAAAGTTTTATTCCTACCTGCTTGCAATA
CGGCGCGTCACAACTTCTTAAAGAGCGAATAAAAGAGCTCTATATCCTAACAGAGGCGCGAGCGCAAAGC
GTTGTCCAGAGAATTGGGATTGGCCAACAAACGAAAAGCGACCTCAGTTTGATGCGAGAGTTTCTCTGGT
TGCAAACATTGAACCGCTGGATTCCATGGTTGCACCTGACTTTGGAGCAACCTGAGACTCGTATAGAAGC
TCTATATGAGGGGTTACTTGCCTTTTCTGGCGAATTAGAGAGTTTCAAACCTGCTGTTGTCCAAGCTCCG
AAACCGCTTAATCGAGATGACCTTAAAAGCGTTTTTGGCCATTTATTCTCAGAGCTTCGAGAGAAACTGT
CGATGGTGCAAAGTGACAGTGTGACCGAATTTTCTTGGGACGAAAACTTATTTGAACGCCGTCGTTTGTT
GCGCTTATCCATTCCTAACCTCAATCAAATGGAGGGTCGCCGTTTTGTTATTTCCGTCCAGTCGTCAATG
GGAACGCCAGCGCTAAGTCAGGTCTTCCCAAGTGCGTGTACGTTGAGCGGCCTGTCAAAAATTGCAGACT
TAGTTCGTAACAGTCAATCTGGTGTTGGTATTCACCTGCTGCCCGTTGCACCGAGTGAATTAAAAGCGCA
AGCAGATGTGGCCTATTTCGAGATCGATTCAGCGCACGAGTATTGGACGCAACTAAAAGCAAAACGTGAA
CCCATTGCGTTGCATGTAGATAGCCGAGTTCCAGACTTATCGATCAAGCTATATGCGCTAGGTTAA
 Primer design