SecReT6
Protein ID: 326794083
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0784
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]845053..846246 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDF2K2M2
KEGG IDmme:Marme_0784
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.40E-40, Aligned region: 54..260
SPOR [PF05036], Evalue: 3.50E-05, Aligned region: 325..391
Protein Sequence: 397 a.a.     [Download]
>gi|326794083|ref|YP_004311903.1| DotU family type IV / VI secretion system protein [Marinomonas mediterranea MMB-1]
MKELLDEETLAIVSDSQGVNADLGSVSARLNNVNALKNHARYSIAQQNGQLFENSILKAGSELLSLTISV
KRMQCPTDMFAFRSGIKNALTDLKYKVAKLDYPPSVADKACFLFAVMLDEQILHSSWGESSGWENQTIVS
ELFGIKNGGEQFYVVAERALLQPVLLVDLLELIYIMLKMGFRGRYRANGKDQLDALMKRIEESVFAQGRS
FSESERLPLLVSDIAEYPKVIKPKKPVRLWRSFASFLFLVGATWLGAYYWYDITLPQKAQPFIQLADYTE
PYYGQASDQDTEYVYYSTAEEMQTAQISFSNQTNAHVTGVSSPQTVWIVQLATFNTIGDAQRFVSQYKRD
LPNASIDAWKGKFRVISESGTKILAARRLNAARAAGISDAFMLNGKQ
 
Nucleotide Sequence: 1194 bp     [Download]
>ref|NC_015276.1|:845053-846246 DotU family type IV / VI secretion system protein [Marinomonas mediterranea MMB-1]
ATGAAAGAACTGTTAGACGAAGAAACCCTTGCGATTGTTAGCGATAGCCAAGGAGTCAATGCGGATTTAG
GTAGTGTGTCGGCACGTTTAAATAACGTGAATGCGCTAAAAAATCATGCTCGCTACAGTATTGCCCAACA
GAATGGACAACTGTTTGAAAACAGCATATTGAAAGCAGGCTCTGAGCTTCTGTCATTGACTATTTCTGTG
AAAAGAATGCAGTGTCCGACGGACATGTTCGCCTTTCGTTCTGGCATTAAAAATGCGCTAACAGATCTTA
AATACAAGGTTGCGAAACTGGATTATCCGCCATCTGTTGCGGATAAGGCCTGTTTTCTTTTCGCCGTGAT
GTTGGATGAGCAAATTTTGCATTCGTCTTGGGGAGAGTCTTCAGGCTGGGAAAATCAGACCATTGTGAGT
GAGTTATTTGGTATAAAAAACGGCGGTGAGCAATTTTATGTTGTCGCTGAAAGAGCCTTATTGCAGCCAG
TTTTATTAGTCGATTTACTTGAGCTGATTTATATCATGCTCAAAATGGGATTTCGTGGCCGTTATCGAGC
AAATGGTAAGGACCAATTAGACGCATTAATGAAGCGGATTGAAGAGTCGGTTTTTGCCCAAGGCCGCTCT
TTTTCTGAATCTGAGCGACTTCCACTTCTGGTCTCTGATATTGCGGAATATCCAAAAGTCATCAAACCTA
AAAAGCCAGTTAGATTGTGGCGTTCGTTTGCTTCTTTTCTTTTTTTAGTGGGAGCGACTTGGTTGGGAGC
GTATTACTGGTATGACATCACATTGCCTCAAAAAGCTCAGCCGTTTATTCAATTAGCAGACTATACCGAA
CCCTATTATGGGCAAGCGAGCGATCAGGATACGGAATATGTGTATTACAGCACTGCTGAAGAAATGCAAA
CAGCACAAATCTCATTTAGTAATCAAACCAACGCTCACGTGACTGGGGTGAGCTCTCCTCAAACAGTGTG
GATTGTTCAGCTTGCGACCTTCAACACGATCGGTGATGCGCAAAGATTTGTGAGTCAGTATAAACGAGAT
TTGCCGAATGCTTCGATTGATGCCTGGAAGGGGAAGTTTCGAGTAATAAGTGAGAGTGGCACCAAAATAT
TAGCAGCGCGAAGATTGAACGCTGCACGTGCCGCCGGTATTTCAGATGCATTTATGTTAAATGGGAAGCA
GTAG
 Primer design