SecReT6
Protein ID: 326794084
SecReT6 ID428
T6SS typei5
Gene symbol-
Locus tagMarme_0785
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]846256..849660 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDF2K2M3
KEGG IDmme:Marme_0785
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.20E-41, Aligned region: 473..766
ImcF-related_N [PF14331], Evalue: 2.80E-39, Aligned region: 165..420
DUF1215 [PF06744], Evalue: 4.80E-13, Aligned region: 273..305
DUF1215 [PF06744], Evalue: 4.80E-13, Aligned region: 885..956
Protein Sequence: 1134 a.a.     [Download]
>gi|326794084|ref|YP_004311904.1| ImcF domain-containing protein [Marinomonas mediterranea MMB-1]
MTGKKKNIAMASSLGLVFSLIIAAIVWLFGVIFLTPLWVVAVEIATFIVVTVLLSWLVYLYLRRPKVDEG
EKQKKDWRDRIVSTRLAQVQKKHSRLSTNPYFVPWYVHLSPSIPEEQLWLQQMGFESIESSEPVPDDLLA
LRFWVSDDAVLISLDLSYEQEVVVASLEALYKHVLKKRPRQAFNGVICSVSLNSLINQSEIGVSDLSQRY
RTILADLNTRTGLALPAYCLFTQMSSVRDFCELFSTLDESEREKAFGSLHALSDGSGYEKTWFDSSFDDL
LARLSVTLSESLKRQLNADYRESSVSGVFQLSALRYDIEDFLSLTFSQHQFDDIELKFRGYFFINAGGET
TSTDILTFMHASDLGFESLEGAHGKTTSLSLFSKSVFKHYIVKEASLVGVHKKKEWRYRTAKLCVSVGLL
SLFAGFVWLLKANYDYQSTIDNKALVMLERYKDNLKHDVIVRDDLSSPIFSLSELREINELYKTEQQPWY
VSKWLPDSGIEKYVSKSYHFELNDVLLTLMRDYILKDMFVYNSLDDKVKTLELLNLHQILYNPNRADVTA
LTHYYISELEEEGEGDADLVDRFKLLAQDVLNSGAVPPAADSELLTLVRSSLSSQDLSELLYQHILQHPE
FARRIDVREQLNPSFTEVFTFKPGFTGYLVPYLFTRRGFEDLYAETGFELATEAIQAYEGVMGRISGDAE
LNRINRQLRERYITDYIHYWKDITSNVTWTSVSSWGDSQIQLELVTDAVFSPITQFYSLVNTHTNLASKG
PEETDKEETQKSTDESDENANDASLNSTIARTAASISAPFLTLHKLVEPNKEGQTRLDIALNKLGQTQDW
VAKSKEITSRGRYFLEQLTNADSSNVLAQLEGVSDDYSDPILPFLLKGQARTINRLALNEMRSVINDDWT
VLSNYYQQRFSGRYPFDRSSIYDTSLADFEDYFKQGGMLDLFHNKYSVYFEQVGSNSTLLKGFIPHQYAS
LSSRYSPFLETAKRFQSGLFIKDKVGFEFFIRAEQMSPNLTRFGLESGARLFEYQNGPLFWQEQSWPIPS
NQTQDIFIVTTDKKGSGTREKAVGEWSWFRIASLMKGATMVGTDDVSWRYVFGDSYTNLRIKSKSGSQPF
SPRFFEGATPPTVL
 
Nucleotide Sequence: 3405 bp     [Download]
>ref|NC_015276.1|:846256-849660 ImcF domain-containing protein [Marinomonas mediterranea MMB-1]
ATGACAGGAAAGAAAAAAAACATAGCAATGGCTTCGAGTTTAGGCCTCGTTTTCAGTCTGATAATCGCGG
CTATAGTTTGGCTATTTGGGGTGATTTTTCTCACACCTCTTTGGGTGGTCGCGGTTGAAATTGCCACGTT
TATTGTGGTTACTGTTCTCTTAAGCTGGCTTGTCTACCTTTATTTACGTCGTCCGAAAGTGGATGAAGGA
GAAAAGCAAAAAAAAGATTGGCGAGATAGAATTGTAAGTACTCGACTGGCTCAAGTTCAAAAGAAACACA
GTCGCTTGTCGACCAACCCTTATTTCGTTCCCTGGTATGTACACCTTTCTCCGAGCATTCCTGAAGAACA
ATTATGGCTTCAGCAAATGGGCTTTGAAAGTATTGAATCGTCTGAGCCTGTTCCAGACGATCTATTAGCA
TTGCGCTTCTGGGTTTCTGATGACGCTGTATTGATATCGCTTGATCTAAGTTATGAACAGGAAGTGGTTG
TCGCCAGCTTAGAAGCGTTGTACAAGCACGTTCTTAAAAAACGTCCGCGCCAAGCGTTCAACGGCGTTAT
CTGTTCTGTCAGCTTGAACAGTTTAATTAATCAAAGTGAAATTGGTGTTAGTGACTTAAGTCAGCGCTAT
CGAACGATATTGGCAGACCTTAATACCCGCACCGGATTGGCTTTGCCTGCTTATTGCCTCTTTACTCAAA
TGTCGAGCGTTCGAGACTTTTGTGAGCTGTTCTCAACGCTGGATGAAAGTGAACGAGAAAAAGCGTTTGG
CTCATTGCACGCCTTGTCGGATGGTAGCGGTTATGAAAAAACGTGGTTTGATAGTTCGTTTGACGACTTA
CTGGCTCGCTTATCCGTTACGCTAAGCGAATCGCTAAAGCGCCAATTAAATGCCGACTATCGAGAGTCTT
CAGTATCAGGCGTATTTCAGTTATCGGCATTGCGGTATGACATAGAAGATTTTTTATCACTGACATTTAG
CCAACACCAGTTTGATGATATTGAACTAAAGTTTCGCGGGTATTTTTTCATTAATGCAGGCGGTGAAACG
ACATCGACCGACATCCTTACTTTTATGCACGCTTCTGATCTGGGGTTTGAATCTCTAGAAGGAGCACATG
GAAAGACGACAAGCTTAAGTCTATTCAGCAAAAGTGTGTTTAAGCATTATATTGTCAAAGAAGCCTCTTT
GGTCGGCGTGCATAAGAAAAAAGAGTGGCGTTATCGCACCGCAAAACTTTGCGTTAGCGTTGGGTTACTT
TCTTTATTTGCTGGTTTCGTCTGGCTTCTAAAAGCCAATTATGATTATCAATCGACCATTGATAATAAAG
CATTGGTCATGCTAGAACGCTACAAAGACAATCTAAAGCACGATGTGATTGTTAGGGATGACCTTTCTTC
TCCGATCTTTAGTTTGTCGGAGCTGAGGGAGATCAATGAACTGTATAAAACGGAACAGCAGCCTTGGTAT
GTGTCGAAATGGTTACCTGATTCGGGGATCGAGAAATACGTTAGTAAGTCCTATCACTTTGAGTTGAATG
ACGTGCTCTTAACACTGATGAGAGACTACATACTGAAAGATATGTTCGTTTATAACTCGCTTGATGACAA
AGTAAAAACGCTAGAGCTTTTAAATTTACATCAGATTTTATACAACCCCAATCGCGCAGATGTTACGGCG
TTAACCCATTACTATATCTCTGAATTGGAGGAAGAAGGAGAGGGTGATGCTGACCTGGTAGATCGCTTTA
AATTGCTTGCGCAGGATGTTTTAAACTCTGGTGCAGTGCCGCCAGCAGCGGATTCTGAATTGTTAACCTT
GGTGCGCTCTTCGTTATCTTCACAAGACCTTAGTGAGTTGCTGTATCAACATATTTTACAGCACCCAGAG
TTTGCTCGCCGAATCGACGTTAGAGAGCAATTGAATCCATCGTTCACTGAGGTGTTTACATTCAAACCTG
GTTTTACAGGTTATCTCGTCCCGTATCTGTTCACTCGACGTGGCTTTGAAGACTTGTATGCAGAAACAGG
CTTTGAGTTAGCAACGGAAGCGATCCAAGCGTACGAAGGTGTGATGGGACGAATCAGTGGTGACGCTGAG
CTAAATCGAATTAATCGTCAGCTTCGCGAACGTTATATCACGGACTATATACACTACTGGAAAGACATTA
CGTCCAACGTAACATGGACCAGTGTCTCATCTTGGGGAGACAGCCAAATACAGCTCGAGTTGGTCACTGA
TGCGGTGTTTTCACCGATTACTCAATTTTATAGCTTAGTTAACACGCATACTAATTTGGCATCAAAAGGT
CCAGAAGAAACAGATAAAGAGGAAACTCAAAAATCAACGGATGAGTCCGACGAAAATGCTAATGACGCTT
CCTTAAACAGTACGATTGCGCGAACGGCTGCTTCAATCAGCGCGCCATTTCTCACGCTACATAAACTAGT
AGAACCCAATAAAGAGGGGCAAACTCGTCTTGATATTGCGCTTAACAAATTAGGACAAACTCAGGATTGG
GTAGCTAAGTCAAAAGAAATTACAAGTCGTGGTCGGTATTTCTTAGAGCAGTTAACCAATGCTGATTCGA
GTAATGTATTGGCTCAGTTAGAAGGGGTGTCCGATGATTACAGCGACCCCATTTTACCTTTCTTACTCAA
AGGACAAGCTCGTACTATTAACCGCTTGGCGTTAAATGAAATGCGCTCGGTGATTAATGATGATTGGACG
GTTCTTTCGAACTACTATCAGCAGCGTTTTTCCGGTCGCTACCCTTTTGATCGTTCATCCATATATGATA
CATCATTAGCTGACTTTGAAGATTACTTTAAACAAGGTGGCATGTTAGATCTGTTTCATAACAAATACAG
CGTTTATTTTGAGCAGGTCGGTTCGAATAGCACCTTGTTAAAGGGCTTTATTCCCCATCAATACGCATCA
TTATCATCGCGATATTCGCCGTTTTTAGAGACCGCTAAACGTTTTCAGAGTGGTTTGTTTATCAAGGATA
AGGTGGGTTTTGAGTTCTTTATTAGAGCGGAGCAGATGTCGCCGAATTTAACGCGTTTTGGTTTGGAATC
CGGAGCGCGTTTATTCGAATATCAAAATGGTCCGCTTTTTTGGCAAGAACAAAGTTGGCCAATACCCAGC
AACCAAACGCAAGATATTTTTATTGTCACGACTGATAAAAAAGGCTCAGGTACTCGAGAAAAGGCCGTAG
GAGAATGGAGTTGGTTTCGCATTGCTAGCCTTATGAAAGGGGCGACAATGGTCGGAACGGATGATGTTTC
TTGGCGTTACGTTTTTGGTGATAGCTATACCAATCTTAGGATCAAATCGAAGAGTGGTAGTCAGCCGTTT
TCACCTCGATTTTTTGAGGGAGCGACGCCTCCAACTGTCTTATGA
 Primer design