SecReT6
Protein ID: 326796902
SecReT6 ID429
T6SS typei2
Gene symbol-
Locus tagMarme_3674
StrainMarinomonas mediterranea MMB-1
Repliconchromosome [GenBank: NC_015276] [Browse all T6SS(s) in this replicon]
Location [Strand]4057228..4060980 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDF2JVZ8
KEGG IDmme:Marme_3674
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.40E-72, Aligned region: 183..443
IcmF-related [PF06761], Evalue: 6.10E-38, Aligned region: 520..837
DUF1215 [PF06744], Evalue: 3.20E-21, Aligned region: 971..1087
AAA_16 [PF13191], Evalue: 0.0029, Aligned region: 122..247
AAA_16 [PF13191], Evalue: 0.0029, Aligned region: 343..403
AAA_16 [PF13191], Evalue: 0.0029, Aligned region: 821..917
Protein Sequence: 1250 a.a.     [Download]
>gi|326796902|ref|YP_004314722.1| type VI secretion protein IcmF [Marinomonas mediterranea MMB-1]
MFKNSIGKLLKGLLLSRLFGMSVGIGAILLLIWVLGGKIGLTSEKLKLQVMAAILACFLLGCLIRKLVFF
LRTKKLKSQLDNAGGSESSGLFQDKISDVLKALKSSQLGAQYRGDKALYALPWYMVIGPSGAGKSTLFAR
SGLDFPLKDDQRFHFQGIGGTRDCDWWFSDKAILIDTAGRYTQDENNDEWINFLRVLKSSRSKAPINGLI
LALPLDEILTTEREALEAHVKYLKNRLHELISELGVTFPIYIVVTKADKLKGFEAFFDDLSPNETKNPWG
IYTLEETENKNVNIAEVVETRLNELYERLLEQTIQKVNLATDTTNKVEAFQFPNQFSGAVDKLNELLRLL
FKDNPYHESPWFAGVYFTSGTQEGDTLERSSNALKSVFAKVGRRFSKTKNNEQSYFIDRLFSDVIFPLKD
AVRGNRKRQRIGRLAKTATVLSTLTILIFSGIGLFTTYTANQLLISDYEEKVKTLMLRVNDSRSSELDRL
NAIVGMYQQYQKLDNIQTYSPLQLVHQYSFVESHGEAIKRLLENTIADTIHQKAVPTLLSSLDEYVTAWP
ELDAAKRKEIQDDYYVSLKTYLMLTSNQDKFDMAFVSQAIGNLWYRSYEEAEVRLNFKERQALFSDMANL
YLSESMSEAGEVRFIGHRDNVSNHESPGYKNPWLLLEPSDGSKDIVATAQAQLTTKADPEALYRRLIAEA
KNRFEAVALSDVLSQSGLSVMYSDASVDGIFTQKAWFDYVSERIDEVSDIASKGDWVLGISEADSNDVDE
SVLLTLRKDIRKRYFHQYTQEWSRFLSSVKVSSFKNLAEATQGLKALGIDHSPWKVLFDRVATEITLVEP
EYKVQLLAQFAKDETPEEAPTGLLDNAGNALDQLPIDIPLIPNFEIAATDLLALVQPVKGASANVNLSLY
QNAMRALSEEFEYILASADINLEAKSYARSLITGDTAGKRQLYSTWIEVNNILLEMSPRESKALSKPFKA
PLSYAWRTILASTRTAIQQDWERRVYGSYLEKVHGRFPFKDNVVDAAPLDVQGLLLPESGDFWMFFKDEI
EPFLRYSNNKWRNRTWLKQGLGVNRQFIESLAGAGRISQALFKQGTAEMKMSYAVYPIPVPGVTESLFEV
NGEGYRYRNEPQEWREFVWRPVDNQGGAKVRVKTAYEANPELLEESGQWALLRLLKKAIVHHIRGTEFEL
EWPMNDVSSAELNADFEGDTTANASGTSVKYRIRADREGSVLNTSIIGDFELPKRLFGAR
 
Nucleotide Sequence: 3753 bp     [Download]
>ref|NC_015276.1|:c4060980-4057228 type VI secretion protein IcmF [Marinomonas mediterranea MMB-1]
ATGTTTAAAAATTCCATTGGCAAGCTGCTAAAGGGCTTGCTGCTATCTCGCTTGTTTGGCATGTCGGTTG
GTATTGGCGCGATACTGCTTTTGATTTGGGTACTAGGAGGCAAAATTGGCCTTACTAGCGAAAAACTAAA
GCTTCAAGTGATGGCTGCTATTCTAGCGTGCTTTCTACTTGGTTGCCTTATTCGCAAACTCGTATTCTTT
TTACGTACTAAAAAGCTTAAGAGCCAATTAGATAATGCCGGTGGGAGTGAGAGCTCTGGCCTGTTTCAGG
ACAAAATTTCTGATGTGTTAAAGGCGCTTAAGTCATCGCAATTGGGCGCGCAGTACCGAGGTGATAAGGC
CTTGTATGCGCTTCCTTGGTACATGGTGATTGGCCCATCTGGCGCAGGAAAAAGTACCTTATTTGCCCGT
TCGGGCCTCGATTTTCCGTTGAAAGACGATCAGCGTTTCCACTTTCAGGGTATTGGTGGAACACGTGATT
GTGATTGGTGGTTTTCTGATAAAGCGATCCTTATTGATACAGCAGGTCGCTACACACAAGATGAAAACAA
CGACGAATGGATTAACTTCTTAAGAGTGTTAAAAAGCAGCCGTTCCAAAGCGCCAATCAACGGTTTGATT
TTGGCTTTACCGCTTGATGAAATTTTGACGACAGAGCGTGAAGCGCTAGAAGCGCATGTGAAGTATCTTA
AAAATCGTCTGCATGAGCTGATTTCAGAATTAGGTGTGACGTTCCCTATTTATATTGTTGTTACGAAAGC
CGATAAGCTGAAAGGCTTTGAGGCATTTTTTGATGACCTAAGTCCTAACGAAACTAAAAATCCGTGGGGG
ATATACACGCTAGAGGAAACTGAAAATAAGAACGTTAATATCGCGGAGGTTGTCGAAACGCGTTTGAATG
AGCTGTATGAGCGGTTGCTAGAACAAACGATACAAAAAGTGAATTTGGCGACTGACACGACTAATAAGGT
AGAAGCTTTTCAGTTTCCAAACCAGTTCTCAGGTGCCGTAGATAAGCTAAACGAACTGTTAAGGTTGTTG
TTTAAAGACAACCCATATCACGAATCACCGTGGTTTGCGGGCGTCTATTTTACATCTGGCACGCAGGAAG
GTGACACATTAGAACGCAGCTCCAATGCGCTAAAAAGTGTCTTTGCGAAAGTGGGCCGACGCTTTTCAAA
AACCAAAAATAATGAACAGAGCTATTTCATTGATAGGTTGTTTTCAGACGTGATTTTCCCGTTAAAAGAT
GCGGTTCGTGGTAACCGTAAACGTCAAAGGATAGGACGTCTAGCCAAAACGGCGACAGTACTTTCAACGC
TTACAATTTTGATTTTTTCAGGTATTGGCTTATTCACAACGTACACCGCCAATCAGTTGCTTATCTCAGA
TTATGAAGAGAAAGTGAAAACCTTGATGCTTCGTGTCAACGATAGTCGTTCCTCTGAATTGGATCGATTG
AATGCGATAGTCGGAATGTACCAGCAGTATCAAAAGCTTGATAATATTCAAACGTACTCGCCACTTCAAC
TCGTGCATCAATATAGTTTTGTTGAGTCCCACGGCGAAGCCATTAAAAGGTTACTAGAGAACACGATAGC
CGATACGATTCATCAAAAAGCGGTTCCTACATTATTGTCGTCATTAGATGAATACGTCACTGCTTGGCCT
GAATTGGATGCGGCTAAGCGTAAAGAGATCCAAGATGACTACTATGTGTCGTTAAAAACGTATCTTATGT
TGACGAGCAATCAAGATAAGTTTGACATGGCGTTTGTTAGTCAAGCGATTGGTAATCTATGGTATCGCTC
GTATGAGGAAGCCGAAGTACGTTTGAATTTTAAAGAACGTCAGGCGTTATTCTCAGACATGGCTAACTTA
TACCTAAGCGAAAGCATGTCTGAAGCAGGAGAGGTCCGTTTTATTGGCCACCGCGATAACGTTTCTAACC
ATGAATCGCCAGGCTATAAGAACCCATGGCTATTACTAGAACCTTCTGATGGTTCAAAAGATATTGTGGC
GACAGCTCAGGCGCAGTTAACCACGAAAGCAGATCCCGAAGCTCTATATCGCCGCTTGATTGCAGAAGCG
AAAAATCGCTTTGAAGCAGTCGCATTATCGGATGTCTTGAGTCAATCCGGGCTTTCAGTGATGTACTCTG
ATGCGTCAGTCGATGGTATTTTCACACAGAAAGCGTGGTTCGATTATGTCTCTGAAAGGATTGATGAAGT
TTCAGACATTGCGAGTAAGGGTGATTGGGTATTAGGGATTTCAGAAGCAGACTCTAACGACGTTGATGAA
TCCGTTTTATTGACACTTCGTAAAGATATTCGTAAACGTTACTTTCATCAATATACGCAGGAATGGTCGC
GTTTCTTAAGTTCTGTCAAAGTGTCTTCGTTCAAAAACTTAGCGGAAGCGACACAAGGCCTTAAAGCACT
GGGTATTGATCATTCGCCTTGGAAAGTTCTTTTCGATCGTGTTGCGACAGAGATTACACTTGTTGAGCCA
GAGTATAAGGTGCAACTTTTAGCTCAATTTGCAAAAGATGAAACGCCAGAAGAGGCGCCGACAGGCCTGC
TCGATAACGCTGGAAATGCGTTGGATCAATTGCCAATCGACATACCTTTGATTCCTAATTTTGAAATTGC
AGCAACTGACTTGTTAGCACTTGTACAACCCGTAAAAGGCGCGTCTGCAAACGTAAACCTATCGTTATAT
CAAAATGCGATGCGAGCGCTGAGTGAGGAATTTGAATATATCTTAGCGTCTGCTGACATCAACCTAGAAG
CGAAGTCTTATGCGCGATCTTTGATAACGGGTGATACGGCAGGCAAGCGTCAGCTGTACAGTACATGGAT
CGAAGTGAATAACATTTTATTAGAGATGTCTCCTCGGGAAAGTAAAGCGCTTAGCAAACCTTTCAAGGCG
CCACTTAGCTATGCTTGGCGAACGATTCTGGCAAGCACCAGAACGGCTATTCAGCAAGATTGGGAAAGAC
GTGTCTACGGTTCTTATTTAGAGAAAGTGCATGGTCGTTTTCCTTTCAAAGACAATGTCGTTGACGCTGC
ACCACTTGATGTTCAGGGATTGCTACTACCGGAATCGGGTGATTTTTGGATGTTCTTTAAAGATGAAATT
GAGCCATTTCTTCGCTACTCAAACAACAAATGGCGTAACCGCACTTGGTTAAAGCAAGGTCTTGGGGTTA
ACCGCCAATTTATTGAGTCTTTAGCGGGGGCGGGCCGTATTTCACAGGCGTTGTTTAAACAAGGCACAGC
GGAGATGAAAATGTCCTATGCGGTATATCCGATCCCCGTTCCAGGGGTGACTGAATCTCTCTTTGAAGTG
AATGGTGAAGGTTATCGATACCGCAACGAGCCACAGGAATGGCGCGAATTTGTATGGCGACCTGTCGATA
ATCAAGGTGGTGCGAAGGTTAGGGTGAAAACGGCGTATGAGGCCAATCCAGAGCTACTTGAAGAGTCAGG
GCAGTGGGCGTTACTTCGACTATTGAAAAAGGCCATAGTTCATCATATTCGCGGAACGGAATTCGAATTA
GAGTGGCCCATGAACGACGTTTCGAGCGCAGAGCTAAACGCTGACTTTGAAGGTGACACCACGGCGAATG
CTTCTGGAACATCGGTAAAATATCGTATCAGAGCGGACCGTGAAGGAAGTGTTCTAAATACCAGTATTAT
CGGCGACTTTGAACTTCCTAAACGCTTATTTGGGGCGCGCTAA
 Primer design