SecReT6
Protein ID: 330500925
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0011
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]12538..15564 [-]
ProductPpkA-like protein
NotePpkA
UniProt IDF4DV27
KEGG IDpmk:MDS_0011
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 7.10E-52, Aligned region: 9..254
Pkinase_Tyr [PF07714], Evalue: 9.00E-35, Aligned region: 11..249
VWA_2 [PF13519], Evalue: 1.10E-11, Aligned region: 113..171
VWA_2 [PF13519], Evalue: 1.10E-11, Aligned region: 591..772
VWA_2 [PF13519], Evalue: 1.10E-11, Aligned region: 848..898
APH [PF01636], Evalue: 6.20E-06, Aligned region: 15..121
APH [PF01636], Evalue: 6.20E-06, Aligned region: 122..150
APH [PF01636], Evalue: 6.20E-06, Aligned region: 240..287
APH [PF01636], Evalue: 6.20E-06, Aligned region: 489..556
VWA [PF00092], Evalue: 0.00026, Aligned region: 591..745
Kinase-like [PF14531], Evalue: 0.00033, Aligned region: 119..210
Protein Sequence: 1008 a.a.     [Download]
>gi|330500925|ref|YP_004377794.1| unnamed protein product [Pseudomonas mendocina NK-01]
MDLNIPGFDIEGVIGEGAMATVYLALQRSLERKVALKIMAPALAADASFCERFLREGKTLARLAHPHIVT
VHDIGNAGEHYYMAMEYLPNGTLRERIAAGLSPEQGLQYIRQIASALGYAHSQGLIHRDVKPANILFRAD
GTAVLSDFGIAKSLDDRTQFTQVGFAVGTPNYMSPEQARGLDIDGRADLYALGVVLYEILVGELPYMGTD
ALSTALAHLTQPLPELPLQHSRYQTLLQRLLAKNPDERFSNAGELLAALDAQPTPEPDPDATLISPALNR
QAAPLSAPSASELGDLQPVSIDIPRSAPNPAPTVAPAPTATAGSGRPSTAASNSPRMALLAVAIAAALGL
GGGAYWWLAQPSPVVASDTPPQRNEQPGADTQQVADTGEAGDHPLLMPGKKTLYQRILAKPGAQLLNAPG
AASGEALPAFSVLYVYAKRSQDGQTWLQVGAASDGRVQGWIAAEQATDWKQSLVLKFTERSGRAPVLFMQ
QAADVERLINRTSQARELLLKAQNDPEQVPQVVALEPTASAVPQDQFYLMPIFDFREAFDAEGQPVQLLN
IASIDPGNAAQSQTPAGKPATATDSGFRTGIVLVVDTSVSMQPYIDRVRQVVSELQSQLQARGELDNVSF
GLVGYRNSTERTPGLQYLSKTLVSLQDGGDPQRFLRAAEQVQATSVSSHSFNEDAFAGVMQAVEGMDWSN
YGGRLILLVSDAGALRKNDPHSSTRMNEAEVRQAALSKQIKIFALHLRTPAGKANHASAEQQYRVLTADS
NPQIGDLYVSVPGGDVEAFGERVREIGSTFAELAQQIRAQQAPVTPQLAGGANLAAKSQAIGYAMHMDFL
GRRSASQAPQLVSAWTADRDLSNPNLPTLQVCVMLTKLQLNDLQQSLKLIVDAARKTKTSPADFFSEIAS
ASAYMSRDPAALRQGANLAQSGVLGEYLDGLPYRSKALSMTQDLWLSLSVAEQEDFIDELESKIRLYETF
HNDMANWVRFGNAEPGDALYRVPLSTLP
 
Nucleotide Sequence: 3027 bp     [Download]
>gi|330500914|ref|NC_015410.1|:c15564-12538 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGGACCTGAACATCCCCGGTTTCGACATCGAAGGCGTGATCGGCGAAGGCGCCATGGCCACCGTATACC
TGGCGCTGCAGCGCTCCCTCGAGCGCAAGGTGGCGTTGAAGATCATGGCCCCGGCGCTGGCGGCCGATGC
CTCGTTCTGCGAGCGCTTCCTGCGCGAGGGCAAGACCCTGGCGCGCCTGGCCCACCCGCACATCGTCACC
GTGCACGACATCGGCAACGCCGGCGAGCACTACTACATGGCCATGGAGTACCTGCCCAACGGTACGCTGC
GCGAGCGCATCGCCGCCGGCCTGAGCCCCGAGCAGGGCCTGCAGTACATTCGCCAGATTGCCTCGGCGCT
GGGCTACGCCCACAGCCAGGGCCTGATCCACCGCGATGTGAAACCGGCCAATATCCTCTTTCGCGCCGAC
GGCACCGCGGTGCTGTCGGACTTCGGTATCGCCAAGTCGCTCGACGACCGCACCCAGTTCACCCAGGTCG
GCTTCGCCGTCGGCACGCCCAACTATATGAGCCCCGAGCAGGCGCGCGGCCTGGATATCGACGGCCGCGC
CGACCTCTATGCGCTGGGCGTGGTGCTCTATGAAATTCTGGTCGGCGAGTTGCCGTACATGGGCACCGAT
GCCCTATCCACGGCGCTGGCGCACCTGACCCAACCATTGCCGGAGCTACCGTTGCAGCACAGCCGCTATC
AGACGCTGCTGCAGCGCCTGCTGGCGAAGAATCCGGATGAACGCTTCAGCAATGCCGGGGAATTGCTGGC
CGCGCTGGATGCCCAGCCGACGCCGGAACCGGACCCGGACGCCACGCTGATCAGTCCGGCGCTCAACCGA
CAAGCCGCCCCCCTGAGTGCGCCATCGGCCAGCGAGCTCGGCGACCTGCAACCGGTCTCCATCGATATTC
CACGCAGCGCGCCGAACCCGGCGCCGACCGTGGCACCCGCACCGACTGCCACGGCAGGCAGCGGGCGGCC
GTCCACTGCTGCTAGCAACAGTCCACGTATGGCACTGCTGGCAGTGGCCATAGCCGCCGCGCTGGGTCTG
GGTGGCGGCGCCTATTGGTGGCTCGCGCAACCGTCTCCGGTGGTGGCCTCGGACACCCCACCGCAGCGCA
ACGAACAGCCAGGCGCAGATACACAGCAAGTGGCCGACACGGGTGAAGCGGGCGACCATCCGTTGCTCAT
GCCGGGCAAGAAGACCCTTTACCAGCGCATCCTGGCCAAGCCCGGCGCGCAACTGCTTAACGCTCCCGGC
GCCGCCAGCGGCGAGGCGCTGCCAGCCTTCTCGGTGCTCTACGTGTACGCCAAGCGCAGCCAGGACGGCC
AGACCTGGCTGCAGGTCGGTGCGGCCAGCGATGGCCGGGTGCAGGGCTGGATCGCCGCCGAACAGGCAAC
CGACTGGAAACAGAGCCTGGTGCTGAAGTTCACCGAACGCTCCGGTCGGGCACCGGTGCTGTTCATGCAG
CAGGCCGCCGACGTGGAGCGCCTGATCAATCGCACCAGCCAGGCTCGCGAGCTGCTGCTCAAGGCGCAGA
ACGACCCCGAGCAGGTACCGCAGGTGGTTGCACTGGAGCCCACCGCCAGCGCCGTGCCGCAGGATCAGTT
CTACCTGATGCCGATCTTCGACTTCCGCGAAGCCTTCGACGCCGAGGGGCAGCCGGTGCAGTTGCTCAAC
ATCGCCTCGATCGATCCCGGCAACGCCGCCCAGTCTCAGACACCTGCCGGCAAGCCGGCGACTGCCACCG
ATTCGGGCTTCCGCACCGGCATCGTGCTGGTGGTCGACACCTCGGTGTCGATGCAACCCTACATCGACCG
CGTACGCCAGGTGGTCAGCGAGCTGCAGAGCCAGCTGCAGGCACGTGGCGAGCTGGATAACGTCAGCTTC
GGTCTGGTCGGCTATCGCAACAGCACCGAGCGCACCCCAGGGCTGCAATACCTGAGCAAGACCCTGGTCA
GCCTGCAGGACGGCGGCGACCCGCAGCGTTTCCTGCGCGCCGCCGAACAGGTGCAGGCGACCAGCGTGTC
CAGCCATTCCTTCAACGAGGATGCGTTCGCCGGCGTCATGCAGGCCGTCGAAGGCATGGACTGGTCGAAC
TATGGCGGGCGCCTGATCCTGCTGGTCAGCGACGCCGGTGCGCTGCGCAAGAACGACCCGCACAGCAGCA
CCCGGATGAACGAGGCCGAGGTACGCCAGGCTGCGCTGAGCAAGCAGATCAAGATCTTCGCCCTGCATCT
GCGCACACCGGCCGGCAAGGCCAACCACGCCTCGGCCGAGCAGCAGTACCGGGTGCTGACGGCCGACAGC
AACCCGCAGATCGGCGACCTCTACGTCTCGGTGCCGGGTGGTGATGTCGAAGCCTTCGGCGAGCGCGTAC
GCGAGATCGGCTCGACCTTCGCCGAACTGGCGCAGCAGATCCGCGCACAGCAGGCACCCGTGACGCCGCA
ACTGGCCGGCGGCGCCAACCTGGCGGCCAAGTCGCAGGCCATCGGCTACGCCATGCACATGGATTTTCTC
GGCCGCCGCAGCGCCAGTCAGGCGCCGCAACTGGTCAGCGCCTGGACCGCCGACCGCGACCTGAGCAACC
CCAACCTGCCAACCCTGCAGGTCTGCGTGATGCTGACCAAACTGCAGCTCAACGACCTGCAGCAGTCGCT
CAAGCTGATCGTCGACGCCGCGCGCAAGACCAAGACCTCGCCGGCCGACTTCTTCAGCGAGATCGCCAGC
GCCAGCGCCTACATGAGTCGTGACCCCGCTGCGCTGCGCCAGGGCGCCAACCTGGCGCAGAGCGGTGTGC
TCGGCGAATACCTCGACGGCCTGCCGTATCGCAGCAAGGCGCTGAGCATGACCCAGGACCTCTGGCTGTC
GCTGTCGGTGGCCGAGCAGGAGGATTTCATCGACGAGCTGGAGTCGAAGATTCGCCTCTACGAAACCTTC
CACAACGACATGGCCAACTGGGTGCGCTTCGGCAATGCCGAGCCGGGCGACGCCCTGTACCGTGTACCGC
TGTCGACGCTGCCATGA
 Primer design