SecReT6
Protein ID: 330500926
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0012
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]15555..16292 [-]
ProductSer/Thr protein phosphatase
NotePppA
UniProt IDF4DV28
KEGG IDpmk:MDS_0012
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.80E-12, Aligned region: 19..205
PP2C [PF00481], Evalue: 7.10E-12, Aligned region: 27..231
SpoIIE [PF07228], Evalue: 1.50E-08, Aligned region: 35..238
Protein Sequence: 245 a.a.     [Download]
>gi|330500926|ref|YP_004377795.1| unnamed protein product [Pseudomonas mendocina NK-01]
MTALHYQSAAYSHVGLVRQINEDAYLERPEAGLWVVADGMGGHAAGDYVSSLIVDSLRNLNASDSLNDYE
QVLRHSLSQVNAAVREQTQLRGVSMMGSTVVLMATRGARGLCLWAGDSRLYRLRSGELQAVSRDHSYVQD
LQDSGLLSEAEARLHPRANVVTRAVGVQDQLELAGSQFEVIPGDTWLLCSDGLTRTAEDHEIRDVLAHAD
PYQVVRSLVHLGLTRGAPDNITAIVIKTSEPASWT
 
Nucleotide Sequence: 738 bp     [Download]
>gi|330500914|ref|NC_015410.1|:c16292-15555 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGACTGCACTGCACTACCAGTCGGCGGCCTACAGTCATGTCGGCCTGGTTCGTCAGATCAACGAAGACG
CTTATCTGGAGCGGCCCGAAGCCGGCCTCTGGGTCGTGGCCGATGGCATGGGCGGACACGCCGCGGGCGA
TTATGTCAGCAGCCTGATCGTCGACAGCCTGCGCAACCTCAACGCAAGCGACAGCCTGAATGACTACGAG
CAGGTACTGCGACACAGCCTCAGCCAGGTCAACGCGGCGGTGCGCGAGCAGACCCAGCTGCGCGGCGTAA
GCATGATGGGCAGCACCGTGGTGCTGATGGCGACGCGTGGCGCCCGTGGCCTGTGCCTGTGGGCCGGCGA
CAGTCGCCTGTACCGGCTGCGCTCGGGCGAGCTGCAGGCGGTTTCGCGTGACCACAGCTACGTGCAGGAC
CTGCAGGACAGCGGCCTGCTCAGCGAGGCCGAGGCGCGTCTGCATCCTCGTGCCAACGTCGTCACCCGCG
CCGTCGGCGTGCAGGACCAGCTGGAACTCGCCGGTAGCCAGTTCGAGGTCATCCCCGGCGATACCTGGCT
GCTGTGCAGCGACGGCCTCACCCGCACCGCCGAAGACCACGAAATCCGCGATGTACTGGCCCATGCCGAC
CCCTATCAGGTGGTGCGCAGTCTGGTTCATCTGGGCCTGACCCGCGGCGCGCCGGACAACATCACCGCCA
TCGTCATCAAGACCAGCGAGCCCGCCTCATGGACCTGA
 Primer design