SecReT6
Protein ID: 330500927
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0013
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]16289..16936 [-]
Producthypothetical protein
NoteTagF
UniProt IDF4DV29
KEGG IDpmk:MDS_0013
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 2.70E-51, Aligned region: 3..137
Protein Sequence: 215 a.a.     [Download]
>gi|330500927|ref|YP_004377796.1| unnamed protein product [Pseudomonas mendocina NK-01]
MMGFYGKVASRGDFIERNLPKDFQRSWDAWLSAGLQASRQQLGEHWLDAYLTSPLWRFALAPGVCGNEAM
MGVLMPSIDRVGRYFPLTIACPIPGGQPLQALQANESWFERIENLLLSTLEEGARFEDFESEVQRLEPLP
DTVTPAHDEAHGLQHWPVVDAAGRLAALAAQACSGASLWWGRGSQRIAAGLRRCQGLPPTESFAVYLLGP
EVVAQ
 
Nucleotide Sequence: 648 bp     [Download]
>gi|330500914|ref|NC_015410.1|:c16936-16289 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGATGGGTTTCTACGGCAAGGTCGCCAGTCGCGGCGACTTCATCGAACGCAATCTGCCGAAGGATTTCC
AGCGCAGCTGGGACGCCTGGCTCTCCGCTGGCCTGCAGGCCAGCCGGCAACAGCTCGGTGAACACTGGCT
GGACGCCTACCTCACCAGCCCGCTGTGGCGCTTCGCCCTGGCACCTGGCGTGTGCGGCAACGAGGCGATG
ATGGGTGTACTGATGCCAAGTATCGACCGAGTTGGCCGTTACTTCCCGCTGACCATCGCCTGTCCTATTC
CCGGTGGGCAACCGCTGCAAGCCTTGCAGGCAAACGAATCGTGGTTCGAGCGGATCGAGAACCTGCTGCT
GAGCACCCTGGAAGAGGGCGCCCGCTTCGAAGACTTCGAAAGCGAGGTGCAGCGCCTGGAACCCTTGCCG
GACACAGTGACACCCGCGCACGACGAGGCACATGGCCTGCAACACTGGCCGGTGGTCGATGCAGCGGGGC
GCCTGGCAGCGCTGGCCGCCCAGGCCTGCAGCGGCGCCAGCCTGTGGTGGGGGCGTGGCTCGCAACGCAT
CGCGGCCGGCCTGCGCCGTTGCCAGGGACTGCCGCCGACCGAGTCGTTCGCGGTTTACCTGCTGGGGCCG
GAGGTGGTCGCGCAATGA
 Primer design