SecReT6
Protein ID: 330500928
SecReT6 ID435
T6SS typei3
Gene symbol-
Locus tagMDS_0014
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T6SS(s) in this replicon]
Location [Strand]16939..20439 [-]
Producthypothetical protein
NoteTssM
UniProt IDF4DV30
KEGG IDpmk:MDS_0014
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-98, Aligned region: 82..122
ImcF-related_N [PF14331], Evalue: 3.50E-98, Aligned region: 187..448
IcmF-related [PF06761], Evalue: 1.50E-86, Aligned region: 498..794
DUF1215 [PF06744], Evalue: 3.00E-40, Aligned region: 65..100
DUF1215 [PF06744], Evalue: 3.00E-40, Aligned region: 904..1025
AAA_19 [PF13245], Evalue: 0.0027, Aligned region: 124..140
AAA_19 [PF13245], Evalue: 0.0027, Aligned region: 530..558
Protein Sequence: 1166 a.a.     [Download]
>gi|330500928|ref|YP_004377797.1| unnamed protein product [Pseudomonas mendocina NK-01]
MKALFGFITRWVIPLLGLIALSLIIWFIGPLLNALQPAWTRWTLIILLFALWLGWRLFCLLRERQQERKV
LDGLAAQAAPDAASVATAEELATLRQRMDEALTLLKKARLGGDERRNLYQLPWYVIIGPPGSGKTTALVN
SGLNFPLAAQLGAGAVRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKTQRARR
PIDGAFIAISLSDLLQSSDSERAAHVAAIRSRVQELYTQLGVRFPVYVMLTKCDLVPGFMEFFDDLSREE
RAQVWGFTFALDDGKSIGGPLEHFDSEFVALEQRLNQRLVERLQRERDPARRDLIYGFPQQFAAIKSLLG
EFLNGVFKPNAYEERSLLRGVYFTSGTQEGSPIDRLIGTMAQSMNLDRQHLARQSGSGRSYFLQHLFSRV
AFAERGLVGVDQKVERRRRWLAIGSLAASVALVLVVSTLWLLSFNANREHIAQVGARTVPLEQQVRSLSP
AQRDVLAVLPLLDAVRNLAGDPPDWAKGLGLYQGDMLEEQAASVYRRLLVATFAPRLLSRVEEQLRSGGG
TDYLYEGLKAYLMLGGGEHYDAEFIKAWIALDWDQSLPRDLPGEQRQALDGHLQALFERRPPDARLDQRL
IDELRMQLQRLPLAQRVYDRVKRQKLPAGVSDFRISEAAGRDAALIFTRKSGKALSDPLSGFYTRRGYRE
AFLRASVGQASVVAEEQWVLGRQLDSTQDAVNLAADVRQLYLRDYVQQWDALLADLDFVSITSVAQAADV
LRILSGPSSPLKQLLIAVARETDLQQAPEAEGVAKTSDEGVDQLKQKLGSLLGQTPAGNAVAAVSEIDPV
SAHFAELNSLVSQDPSAPMAIDGLLADLNELYVQLSSMVGASGEALLGEAKNQASAAAARVNLTAARQPK
LVQGLVGSVVAASTNSMMGGVRNQLNAAWQSDVVNVWRQSLAGRYPMVPGSQRDATLDDFGQFFGVGGVM
DSYFRKYLQPYVDTSARTWRWQPGAAQKLGISAGVLQTFQRAALIRDEFFRSGGLQPSVRFDLKPVSMDA
TISQSQLDLDGQLIGFDHGPSRPVAVQWPNPSSIGVVRLSVSPPVEGGRSALTLEGPWAWFRLLDQSELI
GGASPDRFNLRIRLDRSSVAYELRASSAFNPFKSRAVAGFTLPERL
 
Nucleotide Sequence: 3501 bp     [Download]
>gi|330500914|ref|NC_015410.1|:c20439-16939 Pseudomonas mendocina NK-01 chromosome, complete genome
GTGAAGGCGCTGTTCGGATTCATCACCCGCTGGGTCATCCCGCTGCTCGGGCTGATCGCCCTGAGCCTGA
TCATCTGGTTCATCGGTCCGCTGCTCAATGCACTGCAGCCGGCCTGGACGCGCTGGACGCTGATCATACT
GCTGTTCGCCCTGTGGCTCGGCTGGCGCCTGTTCTGTCTGCTGCGCGAACGCCAGCAGGAACGCAAGGTG
CTCGACGGTCTGGCAGCACAGGCCGCGCCGGACGCCGCCAGCGTGGCCACCGCCGAGGAGCTGGCGACGC
TGCGCCAGCGCATGGACGAAGCCCTGACGCTGCTGAAGAAGGCGCGCCTGGGCGGCGATGAGCGGCGCAA
CCTGTATCAACTGCCGTGGTACGTGATCATCGGGCCACCCGGCTCCGGCAAGACCACCGCACTGGTCAAC
TCCGGCCTGAACTTCCCGCTGGCAGCGCAGTTGGGCGCCGGGGCCGTGCGCGGCGTCGGCGGTACGCGCA
ACTGCGACTGGTGGTTCACCGACGAAGCGGTGCTGCTCGACACCGCCGGGCGCTATACCACTCAGGACAG
CCACGCCCAGGTGGACAAAGCGGCCTGGCTCGGTTTTCTCGACCTGCTCAAGACCCAGCGTGCGCGTCGC
CCGATCGATGGCGCCTTCATCGCCATCAGCCTGTCCGATCTGCTGCAAAGCAGCGACAGCGAGCGCGCCG
CACACGTGGCGGCGATCCGCTCGCGGGTGCAGGAGCTGTATACCCAGCTCGGCGTGCGTTTCCCGGTCTA
CGTGATGCTGACCAAGTGCGACCTGGTGCCGGGCTTCATGGAGTTCTTCGATGACCTCAGCCGTGAGGAA
CGCGCCCAGGTCTGGGGCTTTACCTTCGCCCTGGATGACGGCAAGAGCATCGGCGGCCCGCTGGAACATT
TCGACAGCGAGTTCGTCGCCCTCGAACAGCGCCTCAACCAGCGCCTGGTCGAACGCCTGCAGCGTGAACG
CGATCCGGCACGACGCGACCTGATCTACGGTTTCCCGCAGCAGTTCGCGGCGATCAAGAGCCTGCTCGGC
GAGTTCCTCAACGGCGTGTTCAAACCCAATGCCTACGAGGAGCGCAGCCTGCTGCGCGGTGTGTACTTCA
CCAGCGGCACCCAGGAAGGCAGCCCGATCGACCGCCTGATCGGCACCATGGCACAGAGCATGAACCTCGA
CCGCCAGCACCTGGCCAGGCAGAGCGGCAGCGGCCGCAGCTATTTCCTCCAGCACCTGTTCAGCCGCGTC
GCCTTCGCCGAGCGCGGCCTGGTCGGCGTCGACCAGAAGGTCGAGCGCCGCCGCAGATGGCTGGCCATCG
GCTCGCTGGCCGCCAGCGTGGCACTGGTACTGGTGGTGAGTACGCTGTGGCTGCTCAGCTTCAACGCCAA
CCGTGAGCATATCGCCCAGGTCGGCGCGCGTACCGTGCCGCTGGAGCAGCAGGTGCGCAGCCTCAGCCCG
GCGCAGCGCGACGTGCTGGCGGTATTGCCCCTGCTCGATGCCGTGCGCAACCTGGCCGGCGATCCGCCGG
ACTGGGCCAAGGGCCTGGGTCTGTATCAGGGCGACATGCTCGAGGAGCAGGCCGCCAGCGTCTATCGCCG
TCTGCTGGTAGCCACCTTCGCCCCGCGCCTGCTCAGCCGCGTTGAGGAACAACTGCGTTCCGGCGGTGGC
ACCGATTACCTCTACGAAGGACTCAAGGCCTACCTGATGCTCGGTGGCGGCGAACATTACGACGCCGAGT
TCATCAAGGCCTGGATCGCTCTGGACTGGGATCAGAGCCTGCCGCGTGACTTGCCGGGCGAGCAGCGCCA
GGCGCTCGACGGGCATCTGCAGGCGCTGTTCGAACGTCGTCCACCGGACGCGCGTCTGGATCAGCGCCTG
ATCGACGAGCTGCGCATGCAACTGCAACGTCTGCCGCTGGCGCAGCGCGTATACGACCGGGTCAAGCGGC
AGAAGCTGCCGGCCGGGGTCAGTGACTTCCGCATCAGCGAAGCCGCCGGGCGCGACGCCGCGCTGATCTT
CACGCGCAAGAGTGGCAAGGCGCTGAGCGATCCGCTGAGTGGTTTCTACACCCGCCGCGGCTACCGTGAA
GCCTTCCTCCGCGCCAGCGTCGGCCAGGCCAGCGTGGTAGCCGAGGAACAATGGGTGCTGGGCCGTCAGC
TCGACAGCACTCAGGACGCGGTGAACCTGGCCGCCGATGTACGCCAGCTGTACCTGCGCGATTACGTGCA
ACAGTGGGATGCGCTGCTGGCCGATCTCGACTTCGTGTCGATCACCAGCGTGGCCCAGGCCGCCGACGTG
CTGCGGATACTCTCGGGACCATCCTCGCCGCTCAAGCAGTTGCTGATCGCAGTGGCGCGGGAAACCGATC
TGCAGCAGGCGCCCGAAGCCGAAGGTGTGGCCAAGACCAGCGACGAGGGTGTCGACCAGCTCAAGCAGAA
GCTCGGCTCGCTGCTTGGCCAGACTCCCGCCGGCAATGCCGTGGCGGCGGTGAGCGAGATCGATCCGGTC
AGCGCGCATTTCGCCGAGCTCAACAGCCTGGTCAGCCAGGACCCGTCGGCGCCGATGGCCATCGATGGCC
TGCTGGCGGATCTCAACGAACTTTACGTGCAACTCAGCAGCATGGTCGGCGCCAGCGGCGAGGCGCTGCT
CGGCGAGGCGAAGAACCAGGCCAGTGCCGCCGCGGCAAGGGTCAACCTGACAGCGGCACGTCAGCCGAAG
CTGGTTCAGGGCCTGGTAGGCTCGGTCGTCGCAGCCAGCACCAACAGCATGATGGGCGGGGTGCGCAACC
AGCTCAATGCGGCCTGGCAAAGCGATGTGGTCAATGTCTGGCGGCAGTCGCTGGCCGGCCGTTACCCCAT
GGTGCCGGGTAGCCAGCGCGACGCCACGCTGGATGATTTCGGCCAGTTCTTCGGCGTCGGCGGGGTCATG
GACAGCTACTTCCGCAAGTACCTGCAACCCTACGTCGATACCTCCGCACGCACCTGGCGCTGGCAGCCGG
GCGCGGCACAGAAGCTGGGCATCTCCGCCGGTGTGCTGCAGACCTTCCAGCGCGCAGCCCTGATCCGCGA
CGAATTCTTCCGCAGCGGCGGCCTGCAGCCCAGCGTGCGCTTCGACCTCAAGCCGGTGAGCATGGATGCC
ACCATCAGCCAGTCGCAGCTCGATCTCGACGGCCAACTGATCGGTTTCGACCACGGCCCGAGCCGTCCGG
TGGCGGTGCAATGGCCGAACCCGAGCAGCATCGGCGTGGTACGCCTGTCGGTGTCGCCACCGGTGGAAGG
CGGACGTTCGGCCCTGACCCTGGAAGGGCCCTGGGCCTGGTTCCGTCTGCTCGATCAGTCCGAGCTGATT
GGCGGCGCCTCGCCGGATCGCTTCAACCTGCGTATACGCCTGGATCGTTCCAGCGTTGCCTACGAACTGC
GCGCTAGCAGTGCCTTCAATCCTTTCAAGAGTCGCGCAGTGGCCGGCTTCACCCTGCCGGAGCGGCTATG
A
 Primer design